Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2141014..2141234 Replicon chromosome
Accession NZ_CP098223
Organism Escherichia coli strain Z0117EC0005

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1D7PZ30
Locus tag NBY12_RS10275 Protein ID WP_022645587.1
Coordinates 2141014..2141121 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2141168..2141234 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY12_RS10250 2136859..2137941 + 1083 WP_000804726.1 peptide chain release factor 1 -
NBY12_RS10255 2137941..2138774 + 834 WP_032302913.1 peptide chain release factor N(5)-glutamine methyltransferase -
NBY12_RS10260 2138771..2139163 + 393 WP_000200378.1 invasion regulator SirB2 -
NBY12_RS10265 2139167..2139976 + 810 WP_032302914.1 invasion regulator SirB1 -
NBY12_RS10270 2140012..2140866 + 855 WP_032302915.1 3-deoxy-8-phosphooctulonate synthase -
NBY12_RS10275 2141014..2141121 - 108 WP_022645587.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2141168..2141234 + 67 - - Antitoxin
NBY12_RS10280 2141549..2141656 - 108 WP_000170956.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2141709..2141770 + 62 NuclAT_10 - -
- 2141709..2141770 + 62 NuclAT_10 - -
- 2141709..2141770 + 62 NuclAT_10 - -
- 2141709..2141770 + 62 NuclAT_10 - -
- 2141709..2141770 + 62 NuclAT_12 - -
- 2141709..2141770 + 62 NuclAT_12 - -
- 2141709..2141770 + 62 NuclAT_12 - -
- 2141709..2141770 + 62 NuclAT_12 - -
- 2141709..2141770 + 62 NuclAT_14 - -
- 2141709..2141770 + 62 NuclAT_14 - -
- 2141709..2141770 + 62 NuclAT_14 - -
- 2141709..2141770 + 62 NuclAT_14 - -
- 2141709..2141770 + 62 NuclAT_16 - -
- 2141709..2141770 + 62 NuclAT_16 - -
- 2141709..2141770 + 62 NuclAT_16 - -
- 2141709..2141770 + 62 NuclAT_16 - -
- 2141709..2141770 + 62 NuclAT_18 - -
- 2141709..2141770 + 62 NuclAT_18 - -
- 2141709..2141770 + 62 NuclAT_18 - -
- 2141709..2141770 + 62 NuclAT_18 - -
- 2141709..2141770 + 62 NuclAT_8 - -
- 2141709..2141770 + 62 NuclAT_8 - -
- 2141709..2141770 + 62 NuclAT_8 - -
- 2141709..2141770 + 62 NuclAT_8 - -
- 2141709..2141771 + 63 NuclAT_22 - -
- 2141709..2141771 + 63 NuclAT_22 - -
- 2141709..2141771 + 63 NuclAT_22 - -
- 2141709..2141771 + 63 NuclAT_22 - -
- 2141709..2141771 + 63 NuclAT_26 - -
- 2141709..2141771 + 63 NuclAT_26 - -
- 2141709..2141771 + 63 NuclAT_26 - -
- 2141709..2141771 + 63 NuclAT_26 - -
- 2141709..2141771 + 63 NuclAT_30 - -
- 2141709..2141771 + 63 NuclAT_30 - -
- 2141709..2141771 + 63 NuclAT_30 - -
- 2141709..2141771 + 63 NuclAT_30 - -
- 2141709..2141771 + 63 NuclAT_34 - -
- 2141709..2141771 + 63 NuclAT_34 - -
- 2141709..2141771 + 63 NuclAT_34 - -
- 2141709..2141771 + 63 NuclAT_34 - -
- 2141709..2141771 + 63 NuclAT_38 - -
- 2141709..2141771 + 63 NuclAT_38 - -
- 2141709..2141771 + 63 NuclAT_38 - -
- 2141709..2141771 + 63 NuclAT_38 - -
- 2141709..2141771 + 63 NuclAT_42 - -
- 2141709..2141771 + 63 NuclAT_42 - -
- 2141709..2141771 + 63 NuclAT_42 - -
- 2141709..2141771 + 63 NuclAT_42 - -
- 2141709..2141772 + 64 NuclAT_20 - -
- 2141709..2141772 + 64 NuclAT_20 - -
- 2141709..2141772 + 64 NuclAT_20 - -
- 2141709..2141772 + 64 NuclAT_20 - -
- 2141709..2141772 + 64 NuclAT_24 - -
- 2141709..2141772 + 64 NuclAT_24 - -
- 2141709..2141772 + 64 NuclAT_24 - -
- 2141709..2141772 + 64 NuclAT_24 - -
- 2141709..2141772 + 64 NuclAT_28 - -
- 2141709..2141772 + 64 NuclAT_28 - -
- 2141709..2141772 + 64 NuclAT_28 - -
- 2141709..2141772 + 64 NuclAT_28 - -
- 2141709..2141772 + 64 NuclAT_32 - -
- 2141709..2141772 + 64 NuclAT_32 - -
- 2141709..2141772 + 64 NuclAT_32 - -
- 2141709..2141772 + 64 NuclAT_32 - -
- 2141709..2141772 + 64 NuclAT_36 - -
- 2141709..2141772 + 64 NuclAT_36 - -
- 2141709..2141772 + 64 NuclAT_36 - -
- 2141709..2141772 + 64 NuclAT_36 - -
- 2141709..2141772 + 64 NuclAT_40 - -
- 2141709..2141772 + 64 NuclAT_40 - -
- 2141709..2141772 + 64 NuclAT_40 - -
- 2141709..2141772 + 64 NuclAT_40 - -
NBY12_RS10285 2142062..2143162 - 1101 WP_250777705.1 sodium-potassium/proton antiporter ChaA -
NBY12_RS10290 2143432..2143662 + 231 WP_032302917.1 putative cation transport regulator ChaB -
NBY12_RS10295 2143819..2144514 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
NBY12_RS10300 2144558..2144911 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4029.82 Da        Isoelectric Point: 11.4779

>T247222 WP_022645587.1 NZ_CP098223:c2141121-2141014 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT247222 NZ_CP098223:2141168-2141234 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1D7PZ30

Antitoxin

Download structure file

References