Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2964615..2965446 Replicon chromosome
Accession NZ_CP098219
Organism Escherichia coli strain Z0117EC0013

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag NBY13_RS14540 Protein ID WP_000854814.1
Coordinates 2965072..2965446 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag NBY13_RS14535 Protein ID WP_001546021.1
Coordinates 2964615..2964983 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY13_RS14500 (2959672) 2959672..2960742 + 1071 WP_000102631.1 patatin-like phospholipase family protein -
NBY13_RS14505 (2960878) 2960878..2961555 + 678 WP_001362823.1 hypothetical protein -
NBY13_RS14510 (2961571) 2961571..2961981 + 411 WP_000846704.1 hypothetical protein -
NBY13_RS14515 (2962202) 2962202..2963023 + 822 WP_001234710.1 DUF932 domain-containing protein -
NBY13_RS14520 (2963286) 2963286..2963759 + 474 WP_001385393.1 antirestriction protein -
NBY13_RS14525 (2963775) 2963775..2964251 + 477 WP_001186773.1 RadC family protein -
NBY13_RS14530 (2964314) 2964314..2964535 + 222 WP_000692323.1 DUF987 domain-containing protein -
NBY13_RS14535 (2964615) 2964615..2964983 + 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
NBY13_RS14540 (2965072) 2965072..2965446 + 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
NBY13_RS14545 (2965443) 2965443..2965637 + 195 WP_000988601.1 DUF5983 family protein -
NBY13_RS14550 (2965683) 2965683..2965763 + 81 Protein_2834 hypothetical protein -
NBY13_RS14555 (2966126) 2966126..2966872 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
NBY13_RS14560 (2966887) 2966887..2968428 - 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
NBY13_RS14565 (2968639) 2968639..2968719 - 81 WP_023441679.1 hypothetical protein -
NBY13_RS14570 (2968698) 2968698..2969021 + 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
NBY13_RS14575 (2969122) 2969122..2969451 - 330 WP_000450409.1 DUF496 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T247195 WP_000854814.1 NZ_CP098219:2965072-2965446 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT247195 WP_001546021.1 NZ_CP098219:2964615-2964983 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References