Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4216248..4217083 Replicon chromosome
Accession NZ_CP098217
Organism Escherichia coli strain Z0117EC0032

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0A1A9A5
Locus tag NBY14_RS20070 Protein ID WP_001564063.1
Coordinates 4216706..4217083 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0K5N986
Locus tag NBY14_RS20065 Protein ID WP_021553056.1
Coordinates 4216248..4216616 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY14_RS20030 (4211907) 4211907..4212587 + 681 WP_001278649.1 WYL domain-containing protein -
NBY14_RS20035 (4212738) 4212738..4213415 + 678 WP_001564058.1 hypothetical protein -
NBY14_RS20040 (4213421) 4213421..4213654 + 234 WP_001278293.1 DUF905 family protein -
NBY14_RS20045 (4213744) 4213744..4214562 + 819 WP_001564059.1 DUF932 domain-containing protein -
NBY14_RS20050 (4214828) 4214828..4215307 + 480 WP_001564060.1 antirestriction protein -
NBY14_RS20055 (4215323) 4215323..4215799 + 477 WP_021553055.1 RadC family protein -
NBY14_RS20060 (4215864) 4215864..4216085 + 222 WP_000692345.1 DUF987 domain-containing protein -
NBY14_RS20065 (4216248) 4216248..4216616 + 369 WP_021553056.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NBY14_RS20070 (4216706) 4216706..4217083 + 378 WP_001564063.1 TA system toxin CbtA family protein Toxin
NBY14_RS20075 (4217080) 4217080..4217229 + 150 Protein_3922 DUF5983 family protein -
NBY14_RS20080 (4217308) 4217308..4217502 + 195 WP_024181941.1 DUF957 domain-containing protein -
NBY14_RS20085 (4217587) 4217587..4218429 + 843 Protein_3924 DUF4942 domain-containing protein -
NBY14_RS20090 (4218772) 4218772..4218942 + 171 Protein_3925 IS110 family transposase -
NBY14_RS20095 (4219752) 4219752..4220735 + 984 WP_001296394.1 KpsF/GutQ family sugar-phosphate isomerase -
NBY14_RS20100 (4220807) 4220807..4221955 + 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - papX 4144943..4218556 73613


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14094.09 Da        Isoelectric Point: 7.8045

>T247175 WP_001564063.1 NZ_CP098217:4216706-4217083 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13615.39 Da        Isoelectric Point: 7.0264

>AT247175 WP_021553056.1 NZ_CP098217:4216248-4216616 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A1A9A5

Antitoxin

Source ID Structure
AlphaFold DB A0A0K5N986

References