Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3825411..3826138 | Replicon | chromosome |
Accession | NZ_CP098217 | ||
Organism | Escherichia coli strain Z0117EC0032 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V0YLE2 |
Locus tag | NBY14_RS18125 | Protein ID | WP_000547555.1 |
Coordinates | 3825411..3825722 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NBY14_RS18130 | Protein ID | WP_000126294.1 |
Coordinates | 3825719..3826138 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY14_RS18100 (3821346) | 3821346..3823055 | + | 1710 | WP_001288122.1 | formate hydrogenlyase subunit HycE | - |
NBY14_RS18105 (3823065) | 3823065..3823607 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
NBY14_RS18110 (3823607) | 3823607..3824374 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
NBY14_RS18115 (3824371) | 3824371..3824781 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
NBY14_RS18120 (3824774) | 3824774..3825244 | + | 471 | WP_001551542.1 | hydrogenase maturation peptidase HycI | - |
NBY14_RS18125 (3825411) | 3825411..3825722 | + | 312 | WP_000547555.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
NBY14_RS18130 (3825719) | 3825719..3826138 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
NBY14_RS18135 (3826217) | 3826217..3827641 | - | 1425 | WP_000110355.1 | 6-phospho-beta-glucosidase AscB | - |
NBY14_RS18140 (3827650) | 3827650..3829107 | - | 1458 | WP_001107889.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
NBY14_RS18145 (3829367) | 3829367..3830377 | + | 1011 | WP_029130985.1 | DNA-binding transcriptional regulator AscG | - |
NBY14_RS18150 (3830526) | 3830526..3831053 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12439.18 Da Isoelectric Point: 9.5146
>T247172 WP_000547555.1 NZ_CP098217:3825411-3825722 [Escherichia coli]
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEECARKYPNDALALHSLYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT247172 WP_000126294.1 NZ_CP098217:3825719-3826138 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|