Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3083464..3084295 Replicon chromosome
Accession NZ_CP098217
Organism Escherichia coli strain Z0117EC0032

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag NBY14_RS14695 Protein ID WP_000854814.1
Coordinates 3083921..3084295 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag NBY14_RS14690 Protein ID WP_001285585.1
Coordinates 3083464..3083832 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY14_RS14660 (3080372) 3080372..3080827 + 456 WP_000581504.1 IrmA family protein -
NBY14_RS14665 (3080902) 3080902..3081135 + 234 WP_001119729.1 DUF905 family protein -
NBY14_RS14670 (3081235) 3081235..3082053 + 819 WP_060626401.1 DUF932 domain-containing protein -
NBY14_RS14675 (3082135) 3082135..3082614 + 480 WP_000860087.1 antirestriction protein -
NBY14_RS14680 (3082630) 3082630..3083106 + 477 WP_039267628.1 RadC family protein -
NBY14_RS14685 (3083169) 3083169..3083390 + 222 WP_000692323.1 DUF987 domain-containing protein -
NBY14_RS14690 (3083464) 3083464..3083832 + 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
NBY14_RS14695 (3083921) 3083921..3084295 + 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
NBY14_RS14700 (3084292) 3084292..3084486 + 195 WP_000988600.1 DUF5983 family protein -
NBY14_RS14705 (3084532) 3084532..3084612 + 81 Protein_2864 hypothetical protein -
NBY14_RS14710 (3084901) 3084901..3085029 - 129 Protein_2865 transposase domain-containing protein -
NBY14_RS14715 (3085149) 3085149..3085283 + 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
NBY14_RS14720 (3085384) 3085384..3085713 - 330 WP_000450409.1 DUF496 family protein -
NBY14_RS14725 (3085885) 3085885..3086943 - 1059 WP_001200891.1 FUSC family protein -
NBY14_RS14730 (3087141) 3087141..3087614 - 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
NBY14_RS14735 (3087733) 3087733..3088482 - 750 Protein_2870 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island blaCTX-M-14 - 3062707..3093036 30329


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T247170 WP_000854814.1 NZ_CP098217:3083921-3084295 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT247170 WP_001285585.1 NZ_CP098217:3083464-3083832 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References