Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4094337..4094887 Replicon chromosome
Accession NZ_CP098214
Organism Escherichia coli strain Z0117EC0036

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag NBY15_RS20060 Protein ID WP_001160966.1
Coordinates 4094337..4094651 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag NBY15_RS20065 Protein ID WP_000125566.1
Coordinates 4094654..4094887 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY15_RS20035 (4090012) 4090012..4091298 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
NBY15_RS20040 (4091298) 4091298..4092287 + 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
NBY15_RS20045 (4092284) 4092284..4093105 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NBY15_RS20050 (4093108) 4093108..4093485 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
NBY15_RS20055 (4093492) 4093492..4094340 + 849 WP_000257182.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
NBY15_RS20060 (4094337) 4094337..4094651 - 315 WP_001160966.1 CcdB family protein Toxin
NBY15_RS20065 (4094654) 4094654..4094887 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NBY15_RS20070 (4094973) 4094973..4095452 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
NBY15_RS20075 (4095644) 4095644..4097506 - 1863 WP_021520423.1 glutathione-regulated potassium-efflux system protein KefC -
NBY15_RS20080 (4097499) 4097499..4098029 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
NBY15_RS20085 (4098137) 4098137..4099468 - 1332 WP_001183207.1 MFS transporter -
NBY15_RS20090 (4099527) 4099527..4099814 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T247136 WP_001160966.1 NZ_CP098214:c4094651-4094337 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT247136 WP_000125566.1 NZ_CP098214:c4094887-4094654 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References