Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 574027..574622 | Replicon | chromosome |
Accession | NZ_CP098201 | ||
Organism | Escherichia coli strain Z0117EC0056 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | A0A0V9NWK6 |
Locus tag | NBY20_RS02705 | Protein ID | WP_019842229.1 |
Coordinates | 574272..574622 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | L4JJX7 |
Locus tag | NBY20_RS02700 | Protein ID | WP_001223213.1 |
Coordinates | 574027..574278 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY20_RS02690 (569692) | 569692..573471 | + | 3780 | WP_001550503.1 | autotransporter assembly complex protein TamB | - |
NBY20_RS02695 (573474) | 573474..573815 | + | 342 | WP_001550504.1 | gamma-glutamylcyclotransferase | - |
NBY20_RS02700 (574027) | 574027..574278 | + | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
NBY20_RS02705 (574272) | 574272..574622 | + | 351 | WP_019842229.1 | endoribonuclease toxin ChpB | Toxin |
NBY20_RS02710 (574826) | 574826..575356 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
NBY20_RS02715 (575666) | 575666..576622 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
NBY20_RS02720 (576754) | 576754..578256 | + | 1503 | WP_001550506.1 | sugar ABC transporter ATP-binding protein | - |
NBY20_RS02725 (578270) | 578270..579292 | + | 1023 | WP_001550507.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12483.44 Da Isoelectric Point: 5.6097
>T247001 WP_019842229.1 NZ_CP098201:574272-574622 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVWMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V9NWK6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | L4JJX7 |