Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1896802..1897603 | Replicon | chromosome |
| Accession | NZ_CP098195 | ||
| Organism | Escherichia coli strain Z0117EC0098 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0H2V687 |
| Locus tag | NBY23_RS09525 | Protein ID | WP_000854739.1 |
| Coordinates | 1897223..1897603 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NBY23_RS09520 | Protein ID | WP_021560693.1 |
| Coordinates | 1896802..1897176 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY23_RS09480 (1892814) | 1892814..1893269 | + | 456 | WP_000581502.1 | IrmA family protein | - |
| NBY23_RS09485 (1893412) | 1893412..1893501 | + | 90 | WP_112031555.1 | DUF905 family protein | - |
| NBY23_RS09490 (1893680) | 1893680..1894501 | + | 822 | WP_021560695.1 | DUF932 domain-containing protein | - |
| NBY23_RS09495 (1894501) | 1894501..1894746 | + | 246 | WP_001164966.1 | hypothetical protein | - |
| NBY23_RS09500 (1894840) | 1894840..1895313 | + | 474 | WP_001542276.1 | antirestriction protein | - |
| NBY23_RS09505 (1895329) | 1895329..1895805 | + | 477 | WP_001186170.1 | RadC family protein | - |
| NBY23_RS09510 (1895868) | 1895868..1896089 | + | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| NBY23_RS09515 (1896108) | 1896108..1896752 | + | 645 | WP_021560694.1 | hypothetical protein | - |
| NBY23_RS09520 (1896802) | 1896802..1897176 | + | 375 | WP_021560693.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NBY23_RS09525 (1897223) | 1897223..1897603 | + | 381 | WP_000854739.1 | TA system toxin CbtA family protein | Toxin |
| NBY23_RS09530 (1897600) | 1897600..1898088 | + | 489 | WP_001054232.1 | DUF5983 family protein | - |
| NBY23_RS09535 (1898108) | 1898108..1898305 | + | 198 | WP_000772027.1 | DUF957 domain-containing protein | - |
| NBY23_RS09540 (1898390) | 1898390..1899233 | + | 844 | Protein_1871 | DUF4942 domain-containing protein | - |
| NBY23_RS09550 (1899724) | 1899724..1899942 | - | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
| NBY23_RS09555 (1900227) | 1900227..1900931 | - | 705 | WP_001241678.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14214.14 Da Isoelectric Point: 6.4773
>T246942 WP_000854739.1 NZ_CP098195:1897223-1897603 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ
Download Length: 381 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13863.51 Da Isoelectric Point: 4.5940
>AT246942 WP_021560693.1 NZ_CP098195:1896802-1897176 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWELPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWELPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|