Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 98098..98896 | Replicon | chromosome |
| Accession | NZ_CP098195 | ||
| Organism | Escherichia coli strain Z0117EC0098 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | NBY23_RS00490 | Protein ID | WP_001609485.1 |
| Coordinates | 98098..98475 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NBY23_RS00495 | Protein ID | WP_001609483.1 |
| Coordinates | 98522..98896 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY23_RS00460 (93453) | 93453..94376 | - | 924 | WP_000535960.1 | carboxylate/amino acid/amine transporter | - |
| NBY23_RS00465 (94487) | 94487..95671 | - | 1185 | WP_001172876.1 | sugar efflux transporter | - |
| NBY23_RS00470 (96068) | 96068..96229 | - | 162 | Protein_93 | RhuM family protein | - |
| NBY23_RS00475 (96464) | 96464..97308 | - | 845 | Protein_94 | DUF4942 domain-containing protein | - |
| NBY23_RS00480 (97404) | 97404..97601 | - | 198 | WP_001609487.1 | DUF957 domain-containing protein | - |
| NBY23_RS00485 (97613) | 97613..98101 | - | 489 | WP_001609486.1 | DUF5983 family protein | - |
| NBY23_RS00490 (98098) | 98098..98475 | - | 378 | WP_001609485.1 | TA system toxin CbtA family protein | Toxin |
| NBY23_RS00495 (98522) | 98522..98896 | - | 375 | WP_001609483.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NBY23_RS00500 (98946) | 98946..99590 | - | 645 | WP_001609482.1 | hypothetical protein | - |
| NBY23_RS00505 (99609) | 99609..99830 | - | 222 | WP_001609480.1 | DUF987 domain-containing protein | - |
| NBY23_RS00510 (99899) | 99899..100375 | - | 477 | WP_192851079.1 | RadC family protein | - |
| NBY23_RS00515 (100390) | 100390..100875 | - | 486 | WP_000213697.1 | antirestriction protein | - |
| NBY23_RS00520 (100966) | 100966..101784 | - | 819 | WP_001175160.1 | DUF932 domain-containing protein | - |
| NBY23_RS00525 (101874) | 101874..102107 | - | 234 | WP_001278290.1 | DUF905 family protein | - |
| NBY23_RS00530 (102113) | 102113..102790 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| NBY23_RS00535 (102938) | 102938..103618 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14276.23 Da Isoelectric Point: 7.2141
>T246936 WP_001609485.1 NZ_CP098195:c98475-98098 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKYPEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKYPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13675.54 Da Isoelectric Point: 6.4603
>AT246936 WP_001609483.1 NZ_CP098195:c98896-98522 [Escherichia coli]
VSDTLPGTTLPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLKLMLTSG
ELNPCHQHTVTLYAKGLTCEADTFGSCGYVYLAVYPTLAPATTS
VSDTLPGTTLPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLKLMLTSG
ELNPCHQHTVTLYAKGLTCEADTFGSCGYVYLAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|