Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 10184..10610 | Replicon | plasmid pZ0117ECO0116-2 |
| Accession | NZ_CP098194 | ||
| Organism | Escherichia coli strain Z0117EC0116 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NBY24_RS24880 | Protein ID | WP_001372321.1 |
| Coordinates | 10184..10309 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 10386..10610 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY24_RS24845 (5207) | 5207..5434 | - | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
| NBY24_RS24850 (5571) | 5571..6242 | - | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| NBY24_RS24855 (6436) | 6436..6819 | - | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| NBY24_RS24860 (7142) | 7142..7744 | + | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| NBY24_RS24865 (8041) | 8041..8862 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| NBY24_RS24870 (8973) | 8973..9269 | - | 297 | WP_001272251.1 | hypothetical protein | - |
| NBY24_RS24875 (9569) | 9569..9865 | + | 297 | Protein_16 | hypothetical protein | - |
| NBY24_RS24880 (10184) | 10184..10309 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NBY24_RS24885 (10251) | 10251..10400 | - | 150 | Protein_18 | plasmid maintenance protein Mok | - |
| NBY24_RS24890 (10422) | 10422..10601 | + | 180 | WP_001309233.1 | hypothetical protein | - |
| - (10386) | 10386..10610 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (10386) | 10386..10610 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (10386) | 10386..10610 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (10386) | 10386..10610 | - | 225 | NuclAT_0 | - | Antitoxin |
| NBY24_RS24895 (10579) | 10579..11341 | - | 763 | Protein_20 | plasmid SOS inhibition protein A | - |
| NBY24_RS24900 (11338) | 11338..11772 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| NBY24_RS24905 (11841) | 11841..13864 | - | 2024 | Protein_22 | ParB/RepB/Spo0J family partition protein | - |
| NBY24_RS24910 (13925) | 13925..14158 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
| NBY24_RS24915 (14216) | 14216..14743 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| NBY24_RS24920 (15045) | 15045..15494 | + | 450 | Protein_25 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T246933 WP_001372321.1 NZ_CP098194:c10309-10184 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT246933 NZ_CP098194:c10610-10386 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|