Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2728429..2728654 | Replicon | chromosome |
| Accession | NZ_CP097840 | ||
| Organism | Shigella flexneri strain A | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | M9382_RS13245 | Protein ID | WP_000813254.1 |
| Coordinates | 2728499..2728654 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2728429..2728487 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9382_RS13210 | 2723616..2724878 | - | 1263 | Protein_2570 | tyrosine-type recombinase/integrase | - |
| M9382_RS13220 | 2725216..2726013 | - | 798 | WP_024260703.1 | DgsA anti-repressor MtfA | - |
| M9382_RS13230 | 2726224..2727264 | - | 1041 | WP_005096324.1 | tyrosine-type recombinase/integrase | - |
| M9382_RS13235 | 2727264..2727404 | - | 141 | Protein_2573 | DUF4224 domain-containing protein | - |
| M9382_RS13240 | 2727431..2727847 | + | 417 | WP_005069274.1 | hypothetical protein | - |
| - | 2728429..2728487 | - | 59 | - | - | Antitoxin |
| M9382_RS13245 | 2728499..2728654 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| M9382_RS13250 | 2728822..2729100 | + | 279 | WP_011069426.1 | hypothetical protein | - |
| M9382_RS13255 | 2729102..2730160 | + | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
| M9382_RS13260 | 2730161..2730526 | + | 366 | WP_000140017.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M9382_RS13265 | 2730523..2731211 | + | 689 | Protein_2579 | bacteriophage antitermination protein Q | - |
| M9382_RS13290 | 2732007..2732222 | + | 216 | WP_000839572.1 | class II holin family protein | - |
| M9382_RS13295 | 2732321..2732995 | + | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
| M9382_RS13300 | 2732992..2733342 | + | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 2720308..2763221 | 42913 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T246364 WP_000813254.1 NZ_CP097840:2728499-2728654 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT246364 NZ_CP097840:c2728487-2728429 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|