Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 1681035..1681566 | Replicon | chromosome |
| Accession | NZ_CP097807 | ||
| Organism | Thalassospira sp. GO-4 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | M9H61_RS07930 | Protein ID | WP_250284356.1 |
| Coordinates | 1681035..1681331 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | M9H61_RS07935 | Protein ID | WP_228194201.1 |
| Coordinates | 1681321..1681566 (-) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9H61_RS07900 (M9H61_07900) | 1676529..1676999 | - | 471 | WP_250284349.1 | helix-turn-helix domain-containing protein | - |
| M9H61_RS07905 (M9H61_07905) | 1677136..1677624 | - | 489 | WP_250284351.1 | 3TM-type holin | - |
| M9H61_RS07910 (M9H61_07910) | 1677637..1678113 | - | 477 | WP_250284352.1 | cell wall hydrolase | - |
| M9H61_RS07915 (M9H61_07915) | 1678106..1678420 | - | 315 | WP_068517888.1 | hypothetical protein | - |
| M9H61_RS07920 (M9H61_07920) | 1678737..1679042 | - | 306 | WP_068517887.1 | hypothetical protein | - |
| M9H61_RS07925 (M9H61_07925) | 1679335..1680879 | - | 1545 | WP_250284354.1 | phage terminase large subunit | - |
| M9H61_RS07930 (M9H61_07930) | 1681035..1681331 | - | 297 | WP_250284356.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M9H61_RS07935 (M9H61_07935) | 1681321..1681566 | - | 246 | WP_228194201.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| M9H61_RS07940 (M9H61_07940) | 1681737..1682054 | - | 318 | WP_250284357.1 | hypothetical protein | - |
| M9H61_RS07945 (M9H61_07945) | 1682064..1683161 | - | 1098 | WP_250284359.1 | hypothetical protein | - |
| M9H61_RS07950 (M9H61_07950) | 1683255..1684691 | - | 1437 | WP_250284361.1 | hypothetical protein | - |
| M9H61_RS07955 (M9H61_07955) | 1684696..1685145 | - | 450 | WP_250284363.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1674429..1696267 | 21838 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11411.96 Da Isoelectric Point: 9.4027
>T246259 WP_250284356.1 NZ_CP097807:c1681331-1681035 [Thalassospira sp. GO-4]
MAVNAGYRLTPRAEADLEDIWRYTHRRWSVTQADKYIRDFLGVFSELAASKRIGQKCDVREGYFQTPVGAHVIYYRQASD
AIEVVRVLHGRMDVNRHL
MAVNAGYRLTPRAEADLEDIWRYTHRRWSVTQADKYIRDFLGVFSELAASKRIGQKCDVREGYFQTPVGAHVIYYRQASD
AIEVVRVLHGRMDVNRHL
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|