Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2490143..2490732 | Replicon | chromosome |
| Accession | NZ_CP097804 | ||
| Organism | Xanthomonas oryzae pv. oryzae strain FY517 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | G7TIR7 |
| Locus tag | M9500_RS11845 | Protein ID | WP_012443754.1 |
| Coordinates | 2490143..2490424 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M9500_RS11850 | Protein ID | WP_011260746.1 |
| Coordinates | 2490442..2490732 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9500_RS11840 (M9500_11840) | 2487796..2490048 | + | 2253 | WP_069960050.1 | exodeoxyribonuclease V subunit alpha | - |
| M9500_RS11845 (M9500_11845) | 2490143..2490424 | + | 282 | WP_012443754.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M9500_RS11850 (M9500_11850) | 2490442..2490732 | + | 291 | WP_011260746.1 | HigA family addiction module antitoxin | Antitoxin |
| M9500_RS11855 (M9500_11855) | 2491661..2493055 | + | 1395 | WP_027703652.1 | type III secretion system effector XopQ | - |
| M9500_RS11860 (M9500_11860) | 2493158..2493345 | - | 188 | Protein_2265 | hypothetical protein | - |
| M9500_RS11865 (M9500_11865) | 2493505..2493837 | - | 333 | WP_011260743.1 | hypothetical protein | - |
| M9500_RS11870 (M9500_11870) | 2494092..2494418 | + | 327 | WP_228329596.1 | hypothetical protein | - |
| M9500_RS11875 (M9500_11875) | 2494546..2494968 | + | 423 | WP_042465811.1 | PAAR domain-containing protein | - |
| M9500_RS11880 (M9500_11880) | 2494971..2495579 | + | 609 | WP_113195694.1 | DUF4123 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11066.83 Da Isoelectric Point: 10.5318
>T246254 WP_012443754.1 NZ_CP097804:2490143-2490424 [Xanthomonas oryzae pv. oryzae]
VIRSFIDKDAEKIWLGERSRRLPADIQLVARRKLRMLNAAAHLDDLRIPPANRLEALKGQRRGQYSIRINDQWRICFRWM
EGDVVQVEIVDYH
VIRSFIDKDAEKIWLGERSRRLPADIQLVARRKLRMLNAAAHLDDLRIPPANRLEALKGQRRGQYSIRINDQWRICFRWM
EGDVVQVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|