Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 995514..996168 | Replicon | chromosome |
Accession | NZ_CP097724 | ||
Organism | Escherichia coli strain MS1494 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | M9O75_RS04925 | Protein ID | WP_000244781.1 |
Coordinates | 995761..996168 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | M9O75_RS04920 | Protein ID | WP_000354046.1 |
Coordinates | 995514..995780 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O75_RS04900 (991602) | 991602..993035 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
M9O75_RS04905 (993080) | 993080..993391 | + | 312 | WP_001182948.1 | N(4)-acetylcytidine aminohydrolase | - |
M9O75_RS04910 (993555) | 993555..994214 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
M9O75_RS04915 (994291) | 994291..995271 | - | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
M9O75_RS04920 (995514) | 995514..995780 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
M9O75_RS04925 (995761) | 995761..996168 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
M9O75_RS04930 (996208) | 996208..996729 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
M9O75_RS04935 (996841) | 996841..997737 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
M9O75_RS04940 (997762) | 997762..998472 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M9O75_RS04945 (998478) | 998478..1000211 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T246177 WP_000244781.1 NZ_CP097724:995761-996168 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|