Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 55771..56296 Replicon plasmid pMS1679-1
Accession NZ_CP097720
Organism Escherichia coli strain MS1679

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag M9O74_RS25630 Protein ID WP_001159871.1
Coordinates 55991..56296 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag M9O74_RS25625 Protein ID WP_000813630.1
Coordinates 55771..55989 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O74_RS25595 (51187) 51187..51603 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
M9O74_RS25600 (51600) 51600..51830 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -
M9O74_RS25605 (52095) 52095..52595 + 501 WP_000528932.1 HEPN family nuclease -
M9O74_RS25610 (52608) 52608..53381 + 774 WP_000905949.1 hypothetical protein -
M9O74_RS25615 (53548) 53548..54681 + 1134 WP_000545987.1 DUF3800 domain-containing protein -
M9O74_RS25620 (54715) 54715..55203 - 489 WP_011254646.1 hypothetical protein -
M9O74_RS25625 (55771) 55771..55989 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M9O74_RS25630 (55991) 55991..56296 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
M9O74_RS25635 (56297) 56297..57103 + 807 WP_000016968.1 site-specific integrase -
M9O74_RS25640 (57783) 57783..58514 - 732 WP_260838211.1 replication initiation protein -
M9O74_RS25645 (59135) 59135..60340 + 1206 WP_001442122.1 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iucA / iucB / iucC / iucD / iutA / vat / iroN / iroE / iroD / iroC / iroB 1..201944 201944


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T246144 WP_001159871.1 NZ_CP097720:55991-56296 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT246144 WP_000813630.1 NZ_CP097720:55771-55989 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References