Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3255773..3256478 | Replicon | chromosome |
| Accession | NZ_CP097716 | ||
| Organism | Escherichia coli strain MS1718 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | M9O77_RS15650 | Protein ID | WP_000539521.1 |
| Coordinates | 3255773..3256159 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | M9O77_RS15655 | Protein ID | WP_001280945.1 |
| Coordinates | 3256149..3256478 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9O77_RS15630 (3251777) | 3251777..3252403 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
| M9O77_RS15635 (3252400) | 3252400..3253515 | - | 1116 | WP_000554964.1 | aldose sugar dehydrogenase YliI | - |
| M9O77_RS15640 (3253626) | 3253626..3254009 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| M9O77_RS15645 (3254222) | 3254222..3255547 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| M9O77_RS15650 (3255773) | 3255773..3256159 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M9O77_RS15655 (3256149) | 3256149..3256478 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| M9O77_RS15660 (3256548) | 3256548..3257876 | - | 1329 | WP_022645414.1 | GGDEF domain-containing protein | - |
| M9O77_RS15665 (3257884) | 3257884..3260232 | - | 2349 | WP_022645413.1 | EAL domain-containing protein | - |
| M9O77_RS15670 (3260409) | 3260409..3261320 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T246095 WP_000539521.1 NZ_CP097716:3255773-3256159 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|