Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 857677..858478 Replicon chromosome
Accession NZ_CP097716
Organism Escherichia coli strain MS1718

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag M9O77_RS04060 Protein ID WP_001094436.1
Coordinates 857677..858054 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag M9O77_RS04065 Protein ID WP_015953067.1
Coordinates 858101..858478 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O77_RS04035 (853880) 853880..854050 - 171 Protein_793 IS110 family transposase -
M9O77_RS04040 (854447) 854447..855982 - 1536 WP_000492897.1 EAL domain-containing protein -
M9O77_RS04045 (856053) 856053..856898 - 846 WP_001280513.1 DUF4942 domain-containing protein -
M9O77_RS04050 (856983) 856983..857180 - 198 WP_000839254.1 DUF957 domain-containing protein -
M9O77_RS04055 (857192) 857192..857680 - 489 WP_000761714.1 DUF5983 family protein -
M9O77_RS04060 (857677) 857677..858054 - 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
M9O77_RS04065 (858101) 858101..858478 - 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M9O77_RS04070 (858557) 858557..858778 - 222 WP_000692312.1 DUF987 domain-containing protein -
M9O77_RS04075 (858847) 858847..859323 - 477 WP_001186756.1 RadC family protein -
M9O77_RS04080 (859338) 859338..859823 - 486 WP_000860054.1 antirestriction protein -
M9O77_RS04085 (859914) 859914..860732 - 819 WP_001175142.1 DUF932 domain-containing protein -
M9O77_RS04090 (860822) 860822..861055 - 234 WP_001278287.1 DUF905 family protein -
M9O77_RS04095 (861061) 861061..861738 - 678 WP_001097312.1 hypothetical protein -
M9O77_RS04100 (861886) 861886..862566 - 681 WP_001282927.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element sul2 / tet(B) / aph(3')-Ia / aph(6)-Id / aph(3'')-Ib rfaE / gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / kpsM / kpsT / neuD / neuB / neuA / neuC / neuE / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / papI / papH / papC / papD / papJ / papK / papE / papF / papG 716876..919672 202796
- flank IS/Tn - - 853880..853984 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T246085 WP_001094436.1 NZ_CP097716:c858054-857677 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT246085 WP_015953067.1 NZ_CP097716:c858478-858101 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References