Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1919403..1920234 Replicon chromosome
Accession NZ_CP097711
Organism Escherichia coli strain MS1737

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag M9O76_RS09135 Protein ID WP_000854815.1
Coordinates 1919403..1919777 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2T3TJJ3
Locus tag M9O76_RS09140 Protein ID WP_001285590.1
Coordinates 1919866..1920234 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M9O76_RS09095 (1914798) 1914798..1915964 + 1167 WP_000830157.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
M9O76_RS09100 (1916083) 1916083..1916556 + 474 WP_001105395.1 DNA gyrase inhibitor SbmC -
M9O76_RS09105 (1916755) 1916755..1917813 + 1059 WP_001200890.1 FUSC family protein -
M9O76_RS09110 (1917985) 1917985..1918314 + 330 WP_000450409.1 DUF496 family protein -
M9O76_RS09115 (1918415) 1918415..1918549 - 135 WP_059338447.1 EutP/PduV family microcompartment system protein -
M9O76_RS09120 (1918651) 1918651..1918797 + 147 Protein_1785 transposase domain-containing protein -
M9O76_RS09125 (1919086) 1919086..1919166 - 81 Protein_1786 hypothetical protein -
M9O76_RS09130 (1919212) 1919212..1919406 - 195 WP_000988600.1 DUF5983 family protein -
M9O76_RS09135 (1919403) 1919403..1919777 - 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
M9O76_RS09140 (1919866) 1919866..1920234 - 369 WP_001285590.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
M9O76_RS09145 (1920308) 1920308..1920529 - 222 WP_000692300.1 DUF987 domain-containing protein -
M9O76_RS09150 (1920598) 1920598..1920894 - 297 Protein_1791 hypothetical protein -
M9O76_RS09155 (1921321) 1921321..1921521 - 201 WP_001297900.1 hypothetical protein -
M9O76_RS09160 (1921720) 1921720..1922289 + 570 WP_021576243.1 inovirus Gp2 family protein -
M9O76_RS09165 (1922549) 1922549..1922950 + 402 WP_122989205.1 putative zinc ribbon protein -
M9O76_RS09170 (1922938) 1922938..1923346 + 409 Protein_1795 zinc-ribbon domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T246057 WP_000854815.1 NZ_CP097711:c1919777-1919403 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13608.50 Da        Isoelectric Point: 6.6242

>AT246057 WP_001285590.1 NZ_CP097711:c1920234-1919866 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLYSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A2T3TJJ3

References