Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 833613..834447 | Replicon | chromosome |
Accession | NZ_CP097711 | ||
Organism | Escherichia coli strain MS1737 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A2T3TJB4 |
Locus tag | M9O76_RS04030 | Protein ID | WP_000854811.1 |
Coordinates | 833613..833990 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A2T3TJJ3 |
Locus tag | M9O76_RS04035 | Protein ID | WP_001285590.1 |
Coordinates | 834079..834447 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O76_RS04010 (831411) | 831411..832631 | + | 1221 | WP_000794251.1 | capsular biosynthesis protein | - |
M9O76_RS04015 (832657) | 832657..832887 | - | 231 | Protein_789 | hypothetical protein | - |
M9O76_RS04020 (832993) | 832993..833169 | - | 177 | WP_000839288.1 | DUF957 domain-containing protein | - |
M9O76_RS04025 (833186) | 833186..833616 | - | 431 | Protein_791 | DUF5983 family protein | - |
M9O76_RS04030 (833613) | 833613..833990 | - | 378 | WP_000854811.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
M9O76_RS04035 (834079) | 834079..834447 | - | 369 | WP_001285590.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
M9O76_RS04040 (834521) | 834521..834742 | - | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
M9O76_RS04045 (834811) | 834811..835287 | - | 477 | WP_001536299.1 | RadC family protein | - |
M9O76_RS04050 (835303) | 835303..835788 | - | 486 | WP_000214310.1 | antirestriction protein | - |
M9O76_RS04055 (835880) | 835880..836698 | - | 819 | WP_267326343.1 | DUF932 domain-containing protein | - |
M9O76_RS04060 (836816) | 836816..836987 | - | 172 | Protein_798 | DUF905 family protein | - |
M9O76_RS04065 (837088) | 837088..837543 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14041.14 Da Isoelectric Point: 7.8839
>T246053 WP_000854811.1 NZ_CP097711:c833990-833613 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13608.50 Da Isoelectric Point: 6.6242
>AT246053 WP_001285590.1 NZ_CP097711:c834447-834079 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLYSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLYSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T3TJB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T3TJJ3 |