Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5294..5819 Replicon plasmid unnamed1
Accession NZ_CP097655
Organism Klebsiella pneumoniae strain IR1272_1

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag M3T50_RS26875 Protein ID WP_013023785.1
Coordinates 5294..5599 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag M3T50_RS26880 Protein ID WP_001568025.1
Coordinates 5601..5819 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3T50_RS26845 (989) 989..1615 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
M3T50_RS26850 (1612) 1612..1914 + 303 WP_004197636.1 hypothetical protein -
M3T50_RS26855 (2370) 2370..3164 - 795 WP_004197635.1 site-specific integrase -
M3T50_RS26860 (3362) 3362..4378 - 1017 WP_017899884.1 hypothetical protein -
M3T50_RS26865 (4389) 4389..4703 - 315 WP_053389906.1 hypothetical protein -
M3T50_RS26870 (4730) 4730..5125 - 396 WP_017899885.1 hypothetical protein -
M3T50_RS26875 (5294) 5294..5599 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
M3T50_RS26880 (5601) 5601..5819 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M3T50_RS26885 (5989) 5989..6450 - 462 WP_160866775.1 hypothetical protein -
M3T50_RS26890 (6407) 6407..6637 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
M3T50_RS26895 (6634) 6634..7050 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
M3T50_RS26900 (7124) 7124..8686 + 1563 WP_004206609.1 AAA family ATPase -
M3T50_RS26905 (8671) 8671..9693 + 1023 WP_000361404.1 helicase UvrD -
M3T50_RS26910 (9949) 9949..10646 + 698 WP_223174630.1 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaKPC-2 / blaCTX-M-14b - 1..106759 106759


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T245757 WP_013023785.1 NZ_CP097655:c5599-5294 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT245757 WP_001568025.1 NZ_CP097655:c5819-5601 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References