Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 5294..5819 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP097655 | ||
| Organism | Klebsiella pneumoniae strain IR1272_1 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | D4HQE7 |
| Locus tag | M3T50_RS26875 | Protein ID | WP_013023785.1 |
| Coordinates | 5294..5599 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | W8V2V6 |
| Locus tag | M3T50_RS26880 | Protein ID | WP_001568025.1 |
| Coordinates | 5601..5819 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3T50_RS26845 (989) | 989..1615 | + | 627 | WP_004197649.1 | ParA family plasmid-partitioning AAA ATPase | - |
| M3T50_RS26850 (1612) | 1612..1914 | + | 303 | WP_004197636.1 | hypothetical protein | - |
| M3T50_RS26855 (2370) | 2370..3164 | - | 795 | WP_004197635.1 | site-specific integrase | - |
| M3T50_RS26860 (3362) | 3362..4378 | - | 1017 | WP_017899884.1 | hypothetical protein | - |
| M3T50_RS26865 (4389) | 4389..4703 | - | 315 | WP_053389906.1 | hypothetical protein | - |
| M3T50_RS26870 (4730) | 4730..5125 | - | 396 | WP_017899885.1 | hypothetical protein | - |
| M3T50_RS26875 (5294) | 5294..5599 | - | 306 | WP_013023785.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| M3T50_RS26880 (5601) | 5601..5819 | - | 219 | WP_001568025.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| M3T50_RS26885 (5989) | 5989..6450 | - | 462 | WP_160866775.1 | hypothetical protein | - |
| M3T50_RS26890 (6407) | 6407..6637 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| M3T50_RS26895 (6634) | 6634..7050 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | - |
| M3T50_RS26900 (7124) | 7124..8686 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| M3T50_RS26905 (8671) | 8671..9693 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| M3T50_RS26910 (9949) | 9949..10646 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaKPC-2 / blaCTX-M-14b | - | 1..106759 | 106759 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11615.30 Da Isoelectric Point: 6.4672
>T245757 WP_013023785.1 NZ_CP097655:c5599-5294 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4ZZP8 |