Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 539743..540404 | Replicon | chromosome |
| Accession | NZ_CP097635 | ||
| Organism | Aquincola tertiaricarbonis strain RN12 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | MW290_RS02425 | Protein ID | WP_250195732.1 |
| Coordinates | 539743..540174 (-) | Length | 144 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | MW290_RS02430 | Protein ID | WP_250195733.1 |
| Coordinates | 540171..540404 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MW290_RS02405 (MW290_02405) | 534814..535650 | + | 837 | WP_250195728.1 | amidohydrolase family protein | - |
| MW290_RS02410 (MW290_02410) | 535712..536158 | - | 447 | WP_250195729.1 | hypothetical protein | - |
| MW290_RS02415 (MW290_02415) | 536307..539003 | - | 2697 | WP_250195730.1 | magnesium-translocating P-type ATPase | - |
| MW290_RS02420 (MW290_02420) | 539186..539626 | - | 441 | WP_250195731.1 | addiction module protein | - |
| MW290_RS02425 (MW290_02425) | 539743..540174 | - | 432 | WP_250195732.1 | VapC toxin family PIN domain ribonuclease | Toxin |
| MW290_RS02430 (MW290_02430) | 540171..540404 | - | 234 | WP_250195733.1 | CopG family transcriptional regulator | Antitoxin |
| MW290_RS02435 (MW290_02435) | 540662..540994 | + | 333 | WP_250195734.1 | helix-turn-helix domain-containing protein | - |
| MW290_RS02440 (MW290_02440) | 540987..542453 | + | 1467 | WP_250195735.1 | HipA domain-containing protein | - |
| MW290_RS02445 (MW290_02445) | 542491..543114 | - | 624 | WP_250195736.1 | glutathione S-transferase | - |
| MW290_RS02450 (MW290_02450) | 543123..544376 | - | 1254 | WP_250195737.1 | CaiB/BaiF CoA-transferase family protein | - |
| MW290_RS02455 (MW290_02455) | 544389..545165 | - | 777 | WP_250195738.1 | enoyl-CoA hydratase/isomerase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 539743..548013 | 8270 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15268.68 Da Isoelectric Point: 7.1712
>T245701 WP_250195732.1 NZ_CP097635:c540174-539743 [Aquincola tertiaricarbonis]
VIRYLLDVNVLIALIDPAHVQHDEVHEWFGKVGHKAFATCPITENGLLRIVGHPKYPNCPGPPSAVADALSAIRGLPGHA
FWPDSISLVQSDLVDPALLSSHSRVTDSYLLALARANKGKLATMDHKLATEVVAAGKTALALL
VIRYLLDVNVLIALIDPAHVQHDEVHEWFGKVGHKAFATCPITENGLLRIVGHPKYPNCPGPPSAVADALSAIRGLPGHA
FWPDSISLVQSDLVDPALLSSHSRVTDSYLLALARANKGKLATMDHKLATEVVAAGKTALALL
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|