Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 94730..95156 | Replicon | plasmid pKPC2_140253 |
| Accession | NZ_CP097627 | ||
| Organism | Klebsiella pneumoniae strain 140253 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | M9P58_RS27565 | Protein ID | WP_001372321.1 |
| Coordinates | 94730..94855 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 94932..95156 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9P58_RS27530 (89785) | 89785..90012 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
| M9P58_RS27535 (90106) | 90106..90792 | - | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| M9P58_RS27540 (90983) | 90983..91366 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| M9P58_RS27545 (91643) | 91643..92290 | + | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| M9P58_RS27550 (92587) | 92587..93408 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
| M9P58_RS27555 (93519) | 93519..93815 | - | 297 | WP_001272251.1 | hypothetical protein | - |
| M9P58_RS27560 (94115) | 94115..94411 | + | 297 | Protein_121 | hypothetical protein | - |
| M9P58_RS27565 (94730) | 94730..94855 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| M9P58_RS27570 (94797) | 94797..94946 | - | 150 | Protein_123 | plasmid maintenance protein Mok | - |
| - (94932) | 94932..95156 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (94932) | 94932..95156 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (94932) | 94932..95156 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (94932) | 94932..95156 | - | 225 | NuclAT_0 | - | Antitoxin |
| M9P58_RS27575 (95168) | 95168..95887 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| M9P58_RS27580 (95884) | 95884..96318 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| M9P58_RS27585 (96387) | 96387..98410 | - | 2024 | Protein_126 | ParB/RepB/Spo0J family partition protein | - |
| M9P58_RS27590 (98471) | 98471..98704 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
| M9P58_RS27595 (98762) | 98762..99289 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| M9P58_RS27600 (99591) | 99591..100052 | + | 462 | Protein_129 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..155793 | 155793 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T245688 WP_001372321.1 NZ_CP097627:c94855-94730 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT245688 NZ_CP097627:c95156-94932 [Klebsiella pneumoniae]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|