Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4730168..4730715 | Replicon | chromosome |
| Accession | NZ_CP097576 | ||
| Organism | Microcystis aeruginosa str. Chao 1910 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | I4ITK5 |
| Locus tag | M8120_RS23955 | Protein ID | WP_002803252.1 |
| Coordinates | 4730168..4730446 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | M8120_RS23960 | Protein ID | WP_190359849.1 |
| Coordinates | 4730446..4730715 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M8120_RS23935 (M8120_23710) | 4725330..4725707 | + | 378 | WP_002778608.1 | DUF433 domain-containing protein | - |
| M8120_RS23940 (M8120_23715) | 4725704..4726096 | + | 393 | WP_002791850.1 | hypothetical protein | - |
| M8120_RS23945 (M8120_23720) | 4726262..4727372 | - | 1111 | Protein_4743 | IS630 family transposase | - |
| M8120_RS23950 (M8120_23725) | 4728210..4730034 | + | 1825 | Protein_4744 | group II intron reverse transcriptase/maturase | - |
| M8120_RS23955 (M8120_23730) | 4730168..4730446 | + | 279 | WP_002803252.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M8120_RS23960 (M8120_23735) | 4730446..4730715 | + | 270 | WP_190359849.1 | HigA family addiction module antitoxin | Antitoxin |
| M8120_RS23965 (M8120_23740) | 4730970..4731209 | + | 240 | WP_242030267.1 | hypothetical protein | - |
| M8120_RS23970 (M8120_23745) | 4731239..4731685 | + | 447 | WP_103112768.1 | hypothetical protein | - |
| M8120_RS23975 (M8120_23750) | 4731685..4732260 | + | 576 | WP_265795537.1 | hypothetical protein | - |
| M8120_RS23980 (M8120_23755) | 4732447..4733325 | - | 879 | WP_190359848.1 | UDP-N-acetylmuramate dehydrogenase | - |
| M8120_RS23985 (M8120_23760) | 4733741..4735168 | - | 1428 | WP_190359847.1 | UDP-N-acetylmuramate--L-alanine ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10369.79 Da Isoelectric Point: 8.0988
>T245631 WP_002803252.1 NZ_CP097576:4730168-4730446 [Microcystis aeruginosa str. Chao 1910]
MIVSFKHRGLEQFFESGTTRGIQANHAKRIRLILARLSAATSPQDMNLPGLVLHELAGQRKGTWTVRVSGNWRITFTFDG
VDACDVDLEDYH
MIVSFKHRGLEQFFESGTTRGIQANHAKRIRLILARLSAATSPQDMNLPGLVLHELAGQRKGTWTVRVSGNWRITFTFDG
VDACDVDLEDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|