Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3109837..3110456 Replicon chromosome
Accession NZ_CP097419
Organism Klebsiella pneumoniae strain K229

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M8Y66_RS14990 Protein ID WP_002892050.1
Coordinates 3109837..3110055 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M8Y66_RS14995 Protein ID WP_002892066.1
Coordinates 3110082..3110456 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M8Y66_RS14955 (M8Y66_14955) 3105884..3106147 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
M8Y66_RS14960 (M8Y66_14960) 3106147..3106287 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M8Y66_RS14965 (M8Y66_14965) 3106284..3106982 - 699 WP_002892021.1 GNAT family protein -
M8Y66_RS14970 (M8Y66_14970) 3107083..3108534 + 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
M8Y66_RS14975 (M8Y66_14975) 3108509..3108979 - 471 WP_002892026.1 YlaC family protein -
M8Y66_RS14980 (M8Y66_14980) 3109000..3109140 + 141 WP_004147370.1 hypothetical protein -
M8Y66_RS14985 (M8Y66_14985) 3109112..3109678 - 567 WP_002892030.1 maltose O-acetyltransferase -
M8Y66_RS14990 (M8Y66_14990) 3109837..3110055 - 219 WP_002892050.1 HHA domain-containing protein Toxin
M8Y66_RS14995 (M8Y66_14995) 3110082..3110456 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M8Y66_RS15000 (M8Y66_15000) 3110942..3114088 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M8Y66_RS15005 (M8Y66_15005) 3114111..3115304 - 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T245416 WP_002892050.1 NZ_CP097419:c3110055-3109837 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT245416 WP_002892066.1 NZ_CP097419:c3110456-3110082 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References