Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 58330..59066 | Replicon | plasmid pKPTCM-1 |
| Accession | NZ_CP097386 | ||
| Organism | Klebsiella pneumoniae strain KPTCM | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A2J5Q928 |
| Locus tag | M6G79_RS25170 | Protein ID | WP_004098919.1 |
| Coordinates | 58584..59066 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A7D3T1D0 |
| Locus tag | M6G79_RS25165 | Protein ID | WP_004213599.1 |
| Coordinates | 58330..58596 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M6G79_RS25145 (M6G79_25120) | 55843..56847 | + | 1005 | WP_000427623.1 | IS110-like element IS4321 family transposase | - |
| M6G79_RS25150 (M6G79_25125) | 57133..57627 | + | 495 | WP_004213594.1 | hypothetical protein | - |
| M6G79_RS25155 (M6G79_25130) | 57688..57891 | + | 204 | WP_004213596.1 | HHA domain-containing protein | - |
| M6G79_RS25160 (M6G79_25135) | 57905..58135 | + | 231 | WP_004213598.1 | hypothetical protein | - |
| M6G79_RS25165 (M6G79_25140) | 58330..58596 | + | 267 | WP_004213599.1 | DUF1778 domain-containing protein | Antitoxin |
| M6G79_RS25170 (M6G79_25145) | 58584..59066 | + | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
| M6G79_RS25175 (M6G79_25150) | 59267..60670 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| M6G79_RS25180 (M6G79_25155) | 60699..61331 | - | 633 | WP_001567369.1 | hypothetical protein | - |
| M6G79_RS25185 (M6G79_25160) | 61770..62997 | + | 1228 | Protein_61 | IS3 family transposase | - |
| M6G79_RS25190 (M6G79_25165) | 62993..63388 | - | 396 | Protein_62 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iucA / iucB / iucC / iucD / iutA / rmpA | 1..167179 | 167179 | |
| - | inside | IScluster/Tn | - | - | 47012..62997 | 15985 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T245370 WP_004098919.1 NZ_CP097386:58584-59066 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J5Q928 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D3T1D0 |