Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 536123..536759 | Replicon | chromosome |
| Accession | NZ_CP097374 | ||
| Organism | Bacillus safensis strain AHB11 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A0P7G713 |
| Locus tag | M5E03_RS02595 | Protein ID | WP_024425388.1 |
| Coordinates | 536409..536759 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | W8QJ31 |
| Locus tag | M5E03_RS02590 | Protein ID | WP_003214273.1 |
| Coordinates | 536123..536404 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5E03_RS02570 (M5E03_02570) | 532277..532882 | - | 606 | WP_041116754.1 | rhomboid family intramembrane serine protease | - |
| M5E03_RS02575 (M5E03_02575) | 532977..533342 | + | 366 | WP_061110630.1 | holo-ACP synthase | - |
| M5E03_RS02580 (M5E03_02580) | 533503..534519 | + | 1017 | WP_098677666.1 | outer membrane lipoprotein-sorting protein | - |
| M5E03_RS02585 (M5E03_02585) | 534647..535828 | + | 1182 | WP_034283949.1 | alanine racemase | - |
| M5E03_RS02590 (M5E03_02590) | 536123..536404 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
| M5E03_RS02595 (M5E03_02595) | 536409..536759 | + | 351 | WP_024425388.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| M5E03_RS02600 (M5E03_02600) | 536875..537705 | + | 831 | WP_034283948.1 | RsbT co-antagonist protein RsbRA | - |
| M5E03_RS02605 (M5E03_02605) | 537710..538078 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
| M5E03_RS02610 (M5E03_02610) | 538081..538482 | + | 402 | WP_024427376.1 | anti-sigma regulatory factor | - |
| M5E03_RS02615 (M5E03_02615) | 538493..539500 | + | 1008 | WP_024427377.1 | PP2C family protein-serine/threonine phosphatase | - |
| M5E03_RS02620 (M5E03_02620) | 539560..539889 | + | 330 | WP_024425392.1 | anti-sigma factor antagonist | - |
| M5E03_RS02625 (M5E03_02625) | 539886..540374 | + | 489 | WP_034283945.1 | anti-sigma B factor RsbW | - |
| M5E03_RS02630 (M5E03_02630) | 540340..541128 | + | 789 | WP_048240336.1 | RNA polymerase sigma factor SigB | - |
| M5E03_RS02635 (M5E03_02635) | 541128..541727 | + | 600 | WP_176967302.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8891
>T245337 WP_024425388.1 NZ_CP097374:536409-536759 [Bacillus safensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P7G713 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A081L854 |