Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-MazE |
| Location | 1761351..1762001 | Replicon | chromosome |
| Accession | NZ_CP097335 | ||
| Organism | Mannheimia haemolytica strain NCTC 10208 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M3704_RS08250 | Protein ID | WP_154703935.1 |
| Coordinates | 1761351..1761740 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A1D2Q6P1 |
| Locus tag | M3704_RS08255 | Protein ID | WP_006251766.1 |
| Coordinates | 1761741..1762001 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3704_RS08200 (M3704_08200) | 1756697..1757506 | - | 810 | WP_154703939.1 | metal ABC transporter permease | - |
| M3704_RS08205 (M3704_08205) | 1757499..1758359 | - | 861 | WP_154703938.1 | metal ABC transporter permease | - |
| M3704_RS08210 (M3704_08210) | 1758433..1759218 | - | 786 | WP_154703937.1 | GDP-L-fucose synthase | - |
| M3704_RS08245 (M3704_08245) | 1760083..1761321 | - | 1239 | WP_154703936.1 | peptidase T | - |
| M3704_RS08250 (M3704_08250) | 1761351..1761740 | - | 390 | WP_154703935.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M3704_RS08255 (M3704_08255) | 1761741..1762001 | - | 261 | WP_006251766.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| M3704_RS08260 (M3704_08260) | 1762112..1762324 | - | 213 | WP_126302498.1 | BrnA antitoxin family protein | - |
| M3704_RS08265 (M3704_08265) | 1762471..1762860 | - | 390 | WP_172595359.1 | helix-turn-helix transcriptional regulator | - |
| M3704_RS08270 (M3704_08270) | 1762963..1763220 | + | 258 | WP_126302500.1 | hypothetical protein | - |
| M3704_RS08275 (M3704_08275) | 1763234..1763407 | + | 174 | WP_126302501.1 | excalibur calcium-binding domain-containing protein | - |
| M3704_RS08280 (M3704_08280) | 1763462..1766995 | - | 3534 | WP_154703934.1 | transcription-repair coupling factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14605.86 Da Isoelectric Point: 7.1041
>T245194 WP_154703935.1 NZ_CP097335:c1761740-1761351 [Mannheimia haemolytica]
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSATAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
MYMLDTNTVSYFFRGNANVVAKLKSINPERLCISSATAAELVYGVAKRNNGQLSQFLDYFLSSVKVLDWNYRCAELYGKL
RAEMEKNGKVMGVQDQMIASHALAEECILVSSDQAFKMVPDLKLENWLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|