Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 3813484..3814058 | Replicon | chromosome |
| Accession | NZ_CP097320 | ||
| Organism | Candidatus Mycobacterium methanotrophicum isolate Sulfur Cave | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M5I08_RS19875 | Protein ID | WP_219069929.1 |
| Coordinates | 3813678..3814058 (+) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M5I08_RS19870 | Protein ID | WP_219069927.1 |
| Coordinates | 3813484..3813681 (+) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5I08_RS19845 (M5I08_19845) | 3808966..3809397 | - | 432 | WP_219069917.1 | Hsp20/alpha crystallin family protein | - |
| M5I08_RS19850 (M5I08_19850) | 3809602..3810501 | + | 900 | WP_219069919.1 | universal stress protein | - |
| M5I08_RS19855 (M5I08_19855) | 3810550..3811734 | + | 1185 | WP_219069921.1 | site-2 protease family protein | - |
| M5I08_RS19860 (M5I08_19860) | 3811731..3812543 | + | 813 | WP_219069923.1 | universal stress protein | - |
| M5I08_RS19865 (M5I08_19865) | 3812688..3813119 | - | 432 | WP_249762923.1 | hypothetical protein | - |
| M5I08_RS19870 (M5I08_19870) | 3813484..3813681 | + | 198 | WP_219069927.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M5I08_RS19875 (M5I08_19875) | 3813678..3814058 | + | 381 | WP_219069929.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5I08_RS19880 (M5I08_19880) | 3814167..3815135 | - | 969 | Protein_3947 | proline dehydrogenase family protein | - |
| M5I08_RS19885 (M5I08_19885) | 3815132..3816763 | - | 1632 | WP_219069932.1 | L-glutamate gamma-semialdehyde dehydrogenase | - |
| M5I08_RS19890 (M5I08_19890) | 3816847..3818427 | + | 1581 | WP_219069934.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13643.65 Da Isoelectric Point: 6.9167
>T245137 WP_219069929.1 NZ_CP097320:3813678-3814058 [Candidatus Mycobacterium methanotrophicum]
VILVDTSVWIDHLHKTDPQLVALLGADEVGSHAHVIEELGLGSIRRRAVVLELLGNLHQFPVLSHAEVMALVDSRRLFGR
GLSAVDAHLLGSVSVTGGARLWTRDKRLISACRHIGASYVDDDGAR
VILVDTSVWIDHLHKTDPQLVALLGADEVGSHAHVIEELGLGSIRRRAVVLELLGNLHQFPVLSHAEVMALVDSRRLFGR
GLSAVDAHLLGSVSVTGGARLWTRDKRLISACRHIGASYVDDDGAR
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|