Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2917311..2917999 | Replicon | chromosome |
| Accession | NZ_CP097320 | ||
| Organism | Candidatus Mycobacterium methanotrophicum isolate Sulfur Cave | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | M5I08_RS15125 | Protein ID | WP_219070181.1 |
| Coordinates | 2917311..2917748 (-) | Length | 146 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | M5I08_RS15130 | Protein ID | WP_219070183.1 |
| Coordinates | 2917745..2917999 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5I08_RS15105 (M5I08_15105) | 2912567..2913715 | + | 1149 | WP_219070177.1 | LLM class flavin-dependent oxidoreductase | - |
| M5I08_RS15110 (M5I08_15110) | 2914043..2914291 | + | 249 | Protein_2991 | DUF6444 domain-containing protein | - |
| M5I08_RS15115 (M5I08_15115) | 2914566..2916425 | - | 1860 | WP_249762807.1 | hypothetical protein | - |
| M5I08_RS15120 (M5I08_15120) | 2916445..2917185 | - | 741 | WP_249762808.1 | nitroreductase family protein | - |
| M5I08_RS15125 (M5I08_15125) | 2917311..2917748 | - | 438 | WP_219070181.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M5I08_RS15130 (M5I08_15130) | 2917745..2917999 | - | 255 | WP_219070183.1 | antitoxin | Antitoxin |
| M5I08_RS15135 (M5I08_15135) | 2918073..2918573 | - | 501 | WP_219070185.1 | DUF2505 domain-containing protein | - |
| M5I08_RS15140 (M5I08_15140) | 2918588..2919268 | - | 681 | WP_219070187.1 | flavodoxin family protein | - |
| M5I08_RS15145 (M5I08_15145) | 2919366..2920199 | + | 834 | WP_219070189.1 | class I SAM-dependent methyltransferase | - |
| M5I08_RS15150 (M5I08_15150) | 2920338..2920716 | + | 379 | Protein_2999 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15395.41 Da Isoelectric Point: 6.4832
>T245133 WP_219070181.1 NZ_CP097320:c2917748-2917311 [Candidatus Mycobacterium methanotrophicum]
MRIVDANVLLYAVNTAAGHHEASRRWLDGALSGRDTVGLAWVPLLAFVQLTTRHGLFPSPLTADAAMAQVLDWCNAPASV
IVSPTARHGDVLSGLLSQVGAGGNLVNDAHLAALAIEHRARIVSYDSDFGRFDGVRWETPGSLSN
MRIVDANVLLYAVNTAAGHHEASRRWLDGALSGRDTVGLAWVPLLAFVQLTTRHGLFPSPLTADAAMAQVLDWCNAPASV
IVSPTARHGDVLSGLLSQVGAGGNLVNDAHLAALAIEHRARIVSYDSDFGRFDGVRWETPGSLSN
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|