Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2551035..2551591 | Replicon | chromosome |
| Accession | NZ_CP097320 | ||
| Organism | Candidatus Mycobacterium methanotrophicum isolate Sulfur Cave | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | M5I08_RS13340 | Protein ID | WP_219067761.1 |
| Coordinates | 2551280..2551591 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | M5I08_RS13335 | Protein ID | WP_249763359.1 |
| Coordinates | 2551035..2551280 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5I08_RS13315 (M5I08_13315) | 2546120..2546842 | + | 723 | WP_219067756.1 | cobalt-precorrin-6A reductase | - |
| M5I08_RS13320 (M5I08_13320) | 2547174..2548646 | - | 1473 | WP_219067757.1 | precorrin-2 C(20)-methyltransferase | - |
| M5I08_RS13325 (M5I08_13325) | 2548643..2549269 | - | 627 | WP_219067758.1 | precorrin-8X methylmutase | - |
| M5I08_RS13330 (M5I08_13330) | 2549279..2550376 | - | 1098 | WP_219067759.1 | precorrin-3B synthase | - |
| M5I08_RS13335 (M5I08_13335) | 2551035..2551280 | + | 246 | WP_249763359.1 | YlcI/YnfO family protein | Antitoxin |
| M5I08_RS13340 (M5I08_13340) | 2551280..2551591 | + | 312 | WP_219067761.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M5I08_RS13345 (M5I08_13345) | 2551753..2552499 | - | 747 | WP_219067762.1 | hemerythrin domain-containing protein | - |
| M5I08_RS13350 (M5I08_13350) | 2552798..2553976 | + | 1179 | WP_219067763.1 | PPE family protein | - |
| M5I08_RS13355 (M5I08_13355) | 2554101..2555360 | + | 1260 | WP_219067764.1 | PPE family protein | - |
| M5I08_RS13360 (M5I08_13360) | 2555378..2555686 | + | 309 | WP_219067765.1 | DUF732 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11017.75 Da Isoelectric Point: 5.5815
>T245129 WP_219067761.1 NZ_CP097320:2551280-2551591 [Candidatus Mycobacterium methanotrophicum]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVGPITTTVRGLATEVPVGIVNGLNQPSVVSCDNIQTIPVSDLGRQIGYL
LASQEPALADAIGNAFDLDWVVS
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVGPITTTVRGLATEVPVGIVNGLNQPSVVSCDNIQTIPVSDLGRQIGYL
LASQEPALADAIGNAFDLDWVVS
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|