Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3411583..3412203 | Replicon | chromosome |
| Accession | NZ_CP097262 | ||
| Organism | Salmonella enterica subsp. enterica strain B3-6 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | M3N94_RS16795 | Protein ID | WP_001280991.1 |
| Coordinates | 3411985..3412203 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | M3N94_RS16790 | Protein ID | WP_000344807.1 |
| Coordinates | 3411583..3411957 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3N94_RS16780 (3406722) | 3406722..3407915 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M3N94_RS16785 (3407938) | 3407938..3411087 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| M3N94_RS16790 (3411583) | 3411583..3411957 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| M3N94_RS16795 (3411985) | 3411985..3412203 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| M3N94_RS16800 (3412382) | 3412382..3412933 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| M3N94_RS16805 (3413051) | 3413051..3413521 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| M3N94_RS16810 (3413577) | 3413577..3413717 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| M3N94_RS16815 (3413723) | 3413723..3413983 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| M3N94_RS16820 (3414208) | 3414208..3415758 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| M3N94_RS16830 (3415989) | 3415989..3416378 | + | 390 | WP_000961287.1 | MGMT family protein | - |
| M3N94_RS16835 (3416411) | 3416411..3416980 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T245082 WP_001280991.1 NZ_CP097262:3411985-3412203 [Salmonella enterica subsp. enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT245082 WP_000344807.1 NZ_CP097262:3411583-3411957 [Salmonella enterica subsp. enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|