Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 212526..213168 | Replicon | chromosome |
| Accession | NZ_CP097257 | ||
| Organism | Bacillus thuringiensis strain Bt Gxmzu777-1 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | R8I8B8 |
| Locus tag | M3Y14_RS01195 | Protein ID | WP_000635965.1 |
| Coordinates | 212818..213168 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | R8I8H2 |
| Locus tag | M3Y14_RS01190 | Protein ID | WP_000004570.1 |
| Coordinates | 212526..212813 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3Y14_RS01165 (M3Y14_01160) | 207730..208692 | + | 963 | WP_264539971.1 | UV DNA damage repair endonuclease UvsE | - |
| M3Y14_RS01170 (M3Y14_01165) | 208820..209368 | - | 549 | WP_219916894.1 | rhomboid family intramembrane serine protease | - |
| M3Y14_RS01175 (M3Y14_01170) | 209461..209820 | + | 360 | WP_002029438.1 | holo-ACP synthase | - |
| M3Y14_RS01180 (M3Y14_01175) | 209977..210927 | + | 951 | WP_219921113.1 | outer membrane lipoprotein carrier protein LolA | - |
| M3Y14_RS01185 (M3Y14_01180) | 211045..212214 | + | 1170 | WP_002151404.1 | alanine racemase | - |
| M3Y14_RS01190 (M3Y14_01185) | 212526..212813 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
| M3Y14_RS01195 (M3Y14_01190) | 212818..213168 | + | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| M3Y14_RS01200 (M3Y14_01195) | 213237..215405 | + | 2169 | WP_264541140.1 | Tex family protein | - |
| M3Y14_RS01205 (M3Y14_01200) | 215464..215580 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
| M3Y14_RS01210 (M3Y14_01205) | 215790..216245 | + | 456 | WP_264539972.1 | SprT family protein | - |
| M3Y14_RS01270 (M3Y14_01265) | 217644..218117 | + | 474 | WP_219916896.1 | tRNA (adenosine(37)-N6)-threonylcarbamoyltransferase complex ATPase subunit type 1 TsaE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T245065 WP_000635965.1 NZ_CP097257:212818-213168 [Bacillus thuringiensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366G118 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A366FY90 |