Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 5061014..5061584 | Replicon | chromosome |
| Accession | NZ_CP097252 | ||
| Organism | Mesorhizobium opportunistum strain WSM1558 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | M5D98_RS24695 | Protein ID | WP_224686661.1 |
| Coordinates | 5061014..5061175 (+) | Length | 54 a.a. |
Antitoxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | M5D98_RS24700 | Protein ID | WP_224686660.1 |
| Coordinates | 5061186..5061584 (+) | Length | 133 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5D98_RS24665 (M5D98_24665) | 5056297..5057577 | - | 1281 | WP_023764113.1 | O-acetylhomoserine aminocarboxypropyltransferase | - |
| M5D98_RS24670 (M5D98_24670) | 5057736..5058257 | - | 522 | WP_224686666.1 | CoA-binding protein | - |
| M5D98_RS24675 (M5D98_24675) | 5058254..5059036 | - | 783 | WP_224686665.1 | AAA family ATPase | - |
| M5D98_RS24680 (M5D98_24680) | 5059064..5059486 | - | 423 | WP_224686664.1 | VOC family protein | - |
| M5D98_RS24685 (M5D98_24685) | 5059500..5060321 | - | 822 | WP_224686663.1 | enoyl-CoA hydratase | - |
| M5D98_RS24690 (M5D98_24690) | 5060491..5060940 | + | 450 | WP_224686662.1 | PaaI family thioesterase | - |
| M5D98_RS24695 (M5D98_24695) | 5061014..5061175 | + | 162 | WP_224686661.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| M5D98_RS24700 (M5D98_24700) | 5061186..5061584 | + | 399 | WP_224686660.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| M5D98_RS24705 (M5D98_24705) | 5061849..5062313 | + | 465 | WP_010915638.1 | 50S ribosomal protein L13 | - |
| M5D98_RS24710 (M5D98_24710) | 5062315..5062797 | + | 483 | WP_023764104.1 | 30S ribosomal protein S9 | - |
| M5D98_RS24715 (M5D98_24715) | 5063066..5064121 | - | 1056 | WP_224686659.1 | glycerophosphodiester phosphodiesterase family protein | - |
| M5D98_RS24720 (M5D98_24720) | 5064219..5065427 | - | 1209 | WP_224686658.1 | acyltransferase | - |
| M5D98_RS24725 (M5D98_24725) | 5065552..5066559 | + | 1008 | WP_224686657.1 | agmatinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6003.07 Da Isoelectric Point: 11.3260
>T245044 WP_224686661.1 NZ_CP097252:5061014-5061175 [Mesorhizobium opportunistum]
MKRLKEDGFELISIRGSHHKFRKGEIVLIVPHPEKDLPTGTARAIAKQAGRIR
MKRLKEDGFELISIRGSHHKFRKGEIVLIVPHPEKDLPTGTARAIAKQAGRIR
Download Length: 162 bp
Antitoxin
Download Length: 133 a.a. Molecular weight: 14220.04 Da Isoelectric Point: 4.4101
>AT245044 WP_224686660.1 NZ_CP097252:5061186-5061584 [Mesorhizobium opportunistum]
MKNYFALVDKDPDSAFGIRFPDIPGCFSAADAAEDIVPNAVEALQLWAEDMPVPEPSSHEAIVALPDIRNALAEGGYLVS
VPLIDNDSAVVRANVTFERGVLRAIDAAARERGITRSAFLSSAARREIEAKH
MKNYFALVDKDPDSAFGIRFPDIPGCFSAADAAEDIVPNAVEALQLWAEDMPVPEPSSHEAIVALPDIRNALAEGGYLVS
VPLIDNDSAVVRANVTFERGVLRAIDAAARERGITRSAFLSSAARREIEAKH
Download Length: 399 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|