Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 46372..46793 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP097214 | ||
| Organism | Escherichia coli strain BE311 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | M3O69_RS23655 | Protein ID | WP_096937776.1 |
| Coordinates | 46668..46793 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 46372..46570 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3O69_RS23620 (41475) | 41475..41984 | - | 510 | WP_071532140.1 | hypothetical protein | - |
| M3O69_RS23625 (42302) | 42302..42841 | + | 540 | WP_000290801.1 | single-stranded DNA-binding protein | - |
| M3O69_RS23630 (42898) | 42898..43131 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| M3O69_RS23635 (43197) | 43197..45155 | + | 1959 | WP_000117171.1 | ParB/RepB/Spo0J family partition protein | - |
| M3O69_RS23640 (45210) | 45210..45644 | + | 435 | WP_000845928.1 | conjugation system SOS inhibitor PsiB | - |
| M3O69_RS23645 (45641) | 45641..46403 | + | 763 | Protein_57 | plasmid SOS inhibition protein A | - |
| - (46372) | 46372..46570 | + | 199 | NuclAT_0 | - | Antitoxin |
| - (46372) | 46372..46570 | + | 199 | NuclAT_0 | - | Antitoxin |
| - (46372) | 46372..46570 | + | 199 | NuclAT_0 | - | Antitoxin |
| - (46372) | 46372..46570 | + | 199 | NuclAT_0 | - | Antitoxin |
| M3O69_RS23650 (46577) | 46577..46726 | + | 150 | Protein_58 | DUF5431 family protein | - |
| M3O69_RS23655 (46668) | 46668..46793 | + | 126 | WP_096937776.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| M3O69_RS23660 (47094) | 47094..47371 | - | 278 | Protein_60 | hypothetical protein | - |
| M3O69_RS23665 (47688) | 47688..47975 | + | 288 | WP_000107542.1 | hypothetical protein | - |
| M3O69_RS23670 (48094) | 48094..48915 | + | 822 | WP_001234475.1 | DUF932 domain-containing protein | - |
| M3O69_RS23675 (49211) | 49211..49801 | - | 591 | WP_001375132.1 | transglycosylase SLT domain-containing protein | - |
| M3O69_RS23680 (50153) | 50153..50536 | + | 384 | WP_001063020.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| M3O69_RS23685 (50727) | 50727..51374 | + | 648 | WP_000332520.1 | conjugal transfer transcriptional regulator TraJ | - |
| M3O69_RS23690 (51510) | 51510..51725 | + | 216 | WP_001352842.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | paa | 1..113297 | 113297 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4806.72 Da Isoelectric Point: 8.4890
>T244926 WP_096937776.1 NZ_CP097214:46668-46793 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 199 bp
>AT244926 NZ_CP097214:46372-46570 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|