Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /DUF1778(antitoxin) |
Location | 3449312..3450084 | Replicon | chromosome |
Accession | NZ_CP097127 | ||
Organism | Conexibacter sp. S30A1 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | M3M54_RS16610 | Protein ID | WP_249020130.1 |
Coordinates | 3449584..3450084 (+) | Length | 167 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | M3M54_RS16605 | Protein ID | WP_256465800.1 |
Coordinates | 3449312..3449587 (+) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M54_RS16565 | 3444365..3445150 | - | 786 | WP_249020122.1 | LLM class F420-dependent oxidoreductase | - |
M3M54_RS16570 | 3445202..3445906 | - | 705 | WP_249020123.1 | hypothetical protein | - |
M3M54_RS16580 | 3446466..3447059 | - | 594 | WP_249020124.1 | TetR/AcrR family transcriptional regulator | - |
M3M54_RS16585 | 3447670..3448053 | + | 384 | WP_249020125.1 | hypothetical protein | - |
M3M54_RS16590 | 3448050..3448424 | + | 375 | WP_249020126.1 | transcriptional regulator | - |
M3M54_RS16595 | 3448574..3448864 | - | 291 | WP_249020127.1 | hypothetical protein | - |
M3M54_RS16600 | 3448880..3449098 | - | 219 | WP_249020128.1 | hypothetical protein | - |
M3M54_RS16605 | 3449312..3449587 | + | 276 | WP_256465800.1 | DUF1778 domain-containing protein | Antitoxin |
M3M54_RS16610 | 3449584..3450084 | + | 501 | WP_249020130.1 | GNAT family N-acetyltransferase | Toxin |
M3M54_RS16615 | 3450197..3450670 | - | 474 | WP_249020131.1 | hypothetical protein | - |
M3M54_RS16620 | 3451177..3451362 | - | 186 | WP_249020132.1 | hypothetical protein | - |
M3M54_RS16625 | 3451563..3451952 | + | 390 | WP_249020133.1 | VOC family protein | - |
M3M54_RS16630 | 3452098..3452469 | - | 372 | WP_249020134.1 | PIN domain-containing protein | - |
M3M54_RS16635 | 3452466..3453815 | - | 1350 | WP_249019411.1 | transposase | - |
M3M54_RS16640 | 3454044..3454289 | - | 246 | WP_249020135.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
M3M54_RS16645 | 3454430..3454681 | - | 252 | WP_249020136.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 167 a.a. Molecular weight: 18211.88 Da Isoelectric Point: 10.0108
>T244815 WP_249020130.1 NZ_CP097127:3449584-3450084 [Conexibacter sp. S30A1]
VSGLSLVPLSAGQDLSGFECGNPELDRWLIDHAMASQKADLARTYLVTSADAVAGYVSLTTGSIRPEAAPRRYARGMPRY
PIPTILIARLAIDRRYHRQGLGSRLLAEALRLAVAASDTAAARLVVVDAIDQQAAAFYRRWGFIDVPENPHRLFRKISDI
RTSLPQ
VSGLSLVPLSAGQDLSGFECGNPELDRWLIDHAMASQKADLARTYLVTSADAVAGYVSLTTGSIRPEAAPRRYARGMPRY
PIPTILIARLAIDRRYHRQGLGSRLLAEALRLAVAASDTAAARLVVVDAIDQQAAAFYRRWGFIDVPENPHRLFRKISDI
RTSLPQ
Download Length: 501 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|