Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 1978888..1979533 | Replicon | chromosome |
Accession | NZ_CP097127 | ||
Organism | Conexibacter sp. S30A1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M3M54_RS09740 | Protein ID | WP_249018850.1 |
Coordinates | 1978888..1979304 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | M3M54_RS09745 | Protein ID | WP_249018851.1 |
Coordinates | 1979312..1979533 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M54_RS09720 | 1974298..1975143 | - | 846 | WP_249018846.1 | dTDP-4-dehydrorhamnose reductase | - |
M3M54_RS09725 | 1975265..1976881 | + | 1617 | WP_249018847.1 | circularly permuted type 2 ATP-grasp protein | - |
M3M54_RS09730 | 1976882..1977934 | + | 1053 | WP_249018848.1 | alpha-E domain-containing protein | - |
M3M54_RS09735 | 1977947..1978849 | + | 903 | WP_249018849.1 | transglutaminase family protein | - |
M3M54_RS09740 | 1978888..1979304 | - | 417 | WP_249018850.1 | PIN domain-containing protein | Toxin |
M3M54_RS09745 | 1979312..1979533 | - | 222 | WP_249018851.1 | antitoxin | Antitoxin |
M3M54_RS09750 | 1979618..1980496 | - | 879 | WP_249018852.1 | oxidoreductase | - |
M3M54_RS09755 | 1980649..1981482 | + | 834 | WP_249018853.1 | lysophospholipid acyltransferase family protein | - |
M3M54_RS09760 | 1981506..1982513 | - | 1008 | WP_249018854.1 | ABC transporter permease | - |
M3M54_RS09765 | 1982510..1984051 | - | 1542 | WP_249018855.1 | sugar ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14637.65 Da Isoelectric Point: 6.8384
>T244810 WP_249018850.1 NZ_CP097127:c1979304-1978888 [Conexibacter sp. S30A1]
VGLLDVNALVALAWDSHVHHASVRSWMRSSGRAGWATCPVTESGFVRVSSNPKVLPSPIGVAAARAVLVALRAAEGHRFL
GDEVSECDPDVPEVHGYRQVTDAHLLTLARRHGVRLVTFDSGIAALAQGGDVELLTTI
VGLLDVNALVALAWDSHVHHASVRSWMRSSGRAGWATCPVTESGFVRVSSNPKVLPSPIGVAAARAVLVALRAAEGHRFL
GDEVSECDPDVPEVHGYRQVTDAHLLTLARRHGVRLVTFDSGIAALAQGGDVELLTTI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|