Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK(toxin) |
Location | 1525223..1525806 | Replicon | chromosome |
Accession | NZ_CP097127 | ||
Organism | Conexibacter sp. S30A1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | M3M54_RS07630 | Protein ID | WP_249021573.1 |
Coordinates | 1525223..1525573 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | M3M54_RS07635 | Protein ID | WP_249021574.1 |
Coordinates | 1525570..1525806 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3M54_RS07595 | 1520343..1520726 | - | 384 | WP_249021567.1 | transposase | - |
M3M54_RS07600 | 1520713..1521048 | - | 336 | Protein_1489 | transposase | - |
M3M54_RS07605 | 1521634..1521882 | + | 249 | WP_249021568.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
M3M54_RS07610 | 1521879..1522271 | + | 393 | WP_256465843.1 | PIN domain-containing protein | - |
M3M54_RS07615 | 1522890..1523291 | + | 402 | WP_249021570.1 | hypothetical protein | - |
M3M54_RS07620 | 1523373..1523954 | + | 582 | WP_249021571.1 | DUF6431 domain-containing protein | - |
M3M54_RS07625 | 1524146..1524487 | + | 342 | WP_249021572.1 | hypothetical protein | - |
M3M54_RS07630 | 1525223..1525573 | - | 351 | WP_249021573.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M3M54_RS07635 | 1525570..1525806 | - | 237 | WP_249021574.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
M3M54_RS07640 | 1526512..1529946 | - | 3435 | WP_249021575.1 | bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12274.19 Da Isoelectric Point: 8.7502
>T244808 WP_249021573.1 NZ_CP097127:c1525573-1525223 [Conexibacter sp. S30A1]
VIARGEVWWGDLGLPRGSAPALRRPVLVISADQYNRSRLQTVTVAIITTTQKLAGLPGNVIIPAAVSGLTEDSVLNVTQI
ATLDRGALEERIGTVPDWLLAQVDAGLARALGLTRP
VIARGEVWWGDLGLPRGSAPALRRPVLVISADQYNRSRLQTVTVAIITTTQKLAGLPGNVIIPAAVSGLTEDSVLNVTQI
ATLDRGALEERIGTVPDWLLAQVDAGLARALGLTRP
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|