Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 1288472..1289001 Replicon chromosome
Accession NZ_CP097127
Organism Conexibacter sp. S30A1

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag M3M54_RS06405 Protein ID WP_249021352.1
Coordinates 1288702..1289001 (+) Length 100 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag M3M54_RS06400 Protein ID WP_249021351.1
Coordinates 1288472..1288702 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3M54_RS06365 1283675..1284877 - 1203 WP_249021344.1 TIGR02678 family protein -
M3M54_RS06370 1284874..1286412 - 1539 WP_249021345.1 TIGR02677 family protein -
M3M54_RS06375 1286512..1286736 + 225 WP_249021346.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
M3M54_RS06380 1286891..1287103 - 213 WP_249021347.1 hypothetical protein -
M3M54_RS06385 1287093..1287767 + 675 WP_249021348.1 type II toxin-antitoxin system VapC family toxin -
M3M54_RS06390 1287837..1287998 - 162 WP_249021349.1 hypothetical protein -
M3M54_RS06395 1288070..1288405 + 336 WP_249021350.1 PIN domain-containing protein -
M3M54_RS06400 1288472..1288702 + 231 WP_249021351.1 ribbon-helix-helix domain-containing protein Antitoxin
M3M54_RS06405 1288702..1289001 + 300 WP_249021352.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M3M54_RS06410 1289436..1290008 - 573 WP_249021353.1 hypothetical protein -
M3M54_RS06415 1290013..1290708 - 696 WP_249021354.1 hypothetical protein -
M3M54_RS06420 1290902..1291267 + 366 WP_249021355.1 helix-turn-helix transcriptional regulator -
M3M54_RS06425 1291495..1292364 - 870 WP_249021356.1 hypothetical protein -
M3M54_RS06430 1292525..1293976 - 1452 WP_256465820.1 IS66 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 1288472..1296624 8152


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-95)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 10735.34 Da        Isoelectric Point: 5.8772

>T244806 WP_249021352.1 NZ_CP097127:1288702-1289001 [Conexibacter sp. S30A1]
MRPIHAATLDKSRPVLVLTRELVRPHLNSVTVAPITSTIRGLSTEVKLGTRNGLDHDCVVACDHITTIPAHTLGEQIGLL
LEDQEPALTEAIHAAFDLE

Download         Length: 300 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8180.22 Da        Isoelectric Point: 4.5881

>AT244806 WP_249021351.1 NZ_CP097127:1288472-1288702 [Conexibacter sp. S30A1]
MSKQIAVRLPDDLVDFVDEVVGSGQEASRAAVVTRALERERRRMVATRDAEILASAGPDPELEGLAGYAAGVRVRD

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References