Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3957066..3957685 | Replicon | chromosome |
| Accession | NZ_CP097076 | ||
| Organism | Klebsiella pneumoniae strain KP133 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | M3I84_RS19155 | Protein ID | WP_002892050.1 |
| Coordinates | 3957467..3957685 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | M3I84_RS19150 | Protein ID | WP_002892066.1 |
| Coordinates | 3957066..3957440 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3I84_RS19140 (3952218) | 3952218..3953411 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M3I84_RS19145 (3953434) | 3953434..3956580 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| M3I84_RS19150 (3957066) | 3957066..3957440 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| M3I84_RS19155 (3957467) | 3957467..3957685 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| M3I84_RS19160 (3957844) | 3957844..3958410 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| M3I84_RS19165 (3958382) | 3958382..3958522 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| M3I84_RS19170 (3958543) | 3958543..3959013 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| M3I84_RS19175 (3958988) | 3958988..3960439 | - | 1452 | WP_004177237.1 | PLP-dependent aminotransferase family protein | - |
| M3I84_RS19180 (3960540) | 3960540..3961238 | + | 699 | WP_004177238.1 | GNAT family protein | - |
| M3I84_RS19185 (3961235) | 3961235..3961375 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| M3I84_RS19190 (3961375) | 3961375..3961638 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T244721 WP_002892050.1 NZ_CP097076:3957467-3957685 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT244721 WP_002892066.1 NZ_CP097076:3957066-3957440 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |