Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Txe-Axe/Txe-RelB
Location 16216..16735 Replicon plasmid pAT45b-c
Accession NZ_CP097025
Organism Enterococcus faecium strain AT45b

Toxin (Protein)


Gene name Txe Uniprot ID Q848U6
Locus tag M2917_RS14260 Protein ID WP_000588503.1
Coordinates 16478..16735 (+) Length 86 a.a.

Antitoxin (Protein)


Gene name Axe Uniprot ID Q83WJ8
Locus tag M2917_RS14255 Protein ID WP_000388479.1
Coordinates 16216..16485 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2917_RS14220 (M2917_14220) 11369..12277 + 909 WP_001255866.1 aminoglycoside nucleotidyltransferase ANT(6)-Ia -
M2917_RS14225 (M2917_14225) 12274..12816 + 543 WP_000627290.1 streptothricin N-acetyltransferase Sat4 -
M2917_RS14230 (M2917_14230) 12909..13703 + 795 WP_001096887.1 aminoglycoside O-phosphotransferase APH(3')-IIIa -
M2917_RS14235 (M2917_14235) 14088..14768 - 681 WP_001015311.1 IS6-like element IS1216 family transposase -
M2917_RS14240 (M2917_14240) 14830..15525 + 696 WP_002326819.1 hypothetical protein -
M2917_RS14245 (M2917_14245) 15690..15890 + 201 WP_001033544.1 4-hydroxybenzoate octaprenyltransferase -
M2917_RS14250 (M2917_14250) 15906..16085 + 180 WP_001120991.1 hypothetical protein -
M2917_RS14255 (M2917_14255) 16216..16485 + 270 WP_000388479.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M2917_RS14260 (M2917_14260) 16478..16735 + 258 WP_000588503.1 Txe/YoeB family addiction module toxin Toxin
M2917_RS14265 (M2917_14265) 17194..18198 + 1005 WP_000455809.1 hypothetical protein -
M2917_RS14270 (M2917_14270) 18363..18977 - 615 WP_001261742.1 recombinase family protein -
M2917_RS14275 (M2917_14275) 19427..20752 + 1326 WP_000969590.1 Y-family DNA polymerase -
M2917_RS14280 (M2917_14280) 20745..21095 + 351 WP_000568378.1 hypothetical protein -
M2917_RS14285 (M2917_14285) 21092..21271 + 180 WP_001021554.1 hypothetical protein -
M2917_RS14290 (M2917_14290) 21407..21697 + 291 WP_000026576.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Mobilizable plasmid cat(pC233) / erm(B) / ant(6)-Ia / aph(3')-III - 1..23514 23514


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-85)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-72)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 10206.53 Da        Isoelectric Point: 8.4369

>T244452 WP_000588503.1 NZ_CP097025:16478-16735 [Enterococcus faecium]
MIKAWSDDAWDDYLYWHEQGNKSNIKKINKLIKDIDRSPFAGLGKPEPLKHDLSGKWSRRITDEHRLIYRVENETIFIYS
AKDHY

Download         Length: 258 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10373.51 Da        Isoelectric Point: 4.4346

>AT244452 WP_000388479.1 NZ_CP097025:16216-16485 [Enterococcus faecium]
MEAVAYSNFRQNLRSYMKQVNEDAETLIVTSKDVEDTVVVLSKRDYDSMQETLRTLSNNYVMEKIRRGDEQFSKGAFKTH
DLIEVESDD

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A828ZXQ8

Antitoxin

Source ID Structure
AlphaFold DB A0A828ZWU7

References