Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2341378..2342073 | Replicon | chromosome |
| Accession | NZ_CP096846 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | O53501 |
| Locus tag | M1775_RS10910 | Protein ID | WP_003410811.1 |
| Coordinates | 2341378..2341812 (-) | Length | 145 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TMN0 |
| Locus tag | M1775_RS10915 | Protein ID | WP_003410814.1 |
| Coordinates | 2341819..2342073 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1775_RS10900 (M1775_10905) | 2337532..2340573 | + | 3042 | WP_010950658.1 | DEAD/DEAH box helicase | - |
| M1775_RS10905 (M1775_10910) | 2340566..2341399 | + | 834 | WP_273585949.1 | SWIM zinc finger family protein | - |
| M1775_RS10910 (M1775_10915) | 2341378..2341812 | - | 435 | WP_003410811.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M1775_RS10915 (M1775_10920) | 2341819..2342073 | - | 255 | WP_003410814.1 | antitoxin | Antitoxin |
| M1775_RS10920 (M1775_10925) | 2342089..2342346 | - | 258 | WP_003410816.1 | hypothetical protein | - |
| M1775_RS10925 (M1775_10930) | 2343293..2343589 | + | 297 | WP_003410820.1 | PE family protein | - |
| M1775_RS10930 (M1775_10935) | 2343645..2344376 | + | 732 | WP_003900467.1 | PPE family protein | - |
| M1775_RS10935 (M1775_10940) | 2344916..2345662 | - | 747 | WP_003901330.1 | proteasome subunit alpha | - |
| M1775_RS10940 (M1775_10945) | 2345659..2346534 | - | 876 | WP_003411023.1 | proteasome subunit beta | - |
| M1775_RS10945 (M1775_10950) | 2346531..2346725 | - | 195 | WP_003411026.1 | ubiquitin-like protein Pup | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15662.08 Da Isoelectric Point: 7.4681
>T243942 WP_003410811.1 NZ_CP096846:c2341812-2341378 [Mycobacterium tuberculosis variant bovis]
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
MKIVDANVLLYAVNTTSEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4FB09 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TMN0 |