Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK(toxin) |
| Location | 2300276..2300912 | Replicon | chromosome |
| Accession | NZ_CP096846 | ||
| Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P0CL62 |
| Locus tag | M1775_RS10725 | Protein ID | WP_003410654.1 |
| Coordinates | 2300502..2300912 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P9WJ84 |
| Locus tag | M1775_RS10720 | Protein ID | WP_003410651.1 |
| Coordinates | 2300276..2300509 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M1775_RS10705 (M1775_10710) | 2295733..2296125 | + | 393 | WP_229303073.1 | metal ABC transporter permease | - |
| M1775_RS10710 (M1775_10715) | 2296126..2296530 | - | 405 | WP_003410645.1 | PPOX class F420-dependent oxidoreductase | - |
| M1775_RS10715 (M1775_10720) | 2296614..2300198 | - | 3585 | WP_010950652.1 | cobaltochelatase subunit CobN | - |
| M1775_RS10720 (M1775_10725) | 2300276..2300509 | + | 234 | WP_003410651.1 | type II toxin-antitoxin system antitoxin MazE7 | Antitoxin |
| M1775_RS10725 (M1775_10730) | 2300502..2300912 | + | 411 | WP_003410654.1 | type II toxin-antitoxin system toxin endoribonuclease MazF7 | Toxin |
| M1775_RS10730 (M1775_10735) | 2300896..2301987 | + | 1092 | WP_003900454.1 | precorrin-3B synthase | - |
| M1775_RS10735 (M1775_10740) | 2301997..2302623 | + | 627 | WP_003410658.1 | precorrin-8X methylmutase | - |
| M1775_RS10740 (M1775_10745) | 2302620..2304146 | + | 1527 | WP_003410659.1 | precorrin-2 C(20)-methyltransferase | - |
| M1775_RS10745 (M1775_10750) | 2304092..2305315 | - | 1224 | WP_003901321.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14235.42 Da Isoelectric Point: 10.6228
>T243941 WP_003410654.1 NZ_CP096846:2300502-2300912 [Mycobacterium tuberculosis variant bovis]
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|