Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1687422..1688038 | Replicon | chromosome |
Accession | NZ_CP096846 | ||
Organism | Mycobacterium tuberculosis variant bovis strain Mb2377 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TJ74 |
Locus tag | M1775_RS07960 | Protein ID | WP_003407593.1 |
Coordinates | 1687721..1688038 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TJ73 |
Locus tag | M1775_RS07955 | Protein ID | WP_003900349.1 |
Coordinates | 1687422..1687724 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M1775_RS07945 (M1775_07950) | 1683308..1685155 | + | 1848 | WP_003407585.1 | methylmalonyl-CoA mutase small subunit | - |
M1775_RS07950 (M1775_07955) | 1685156..1687408 | + | 2253 | WP_273586080.1 | methylmalonyl-CoA mutase | - |
M1775_RS07955 (M1775_07960) | 1687422..1687724 | + | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
M1775_RS07960 (M1775_07965) | 1687721..1688038 | + | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
M1775_RS07965 (M1775_07970) | 1688035..1689039 | + | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
M1775_RS07970 (M1775_07975) | 1689092..1690381 | + | 1290 | WP_003407599.1 | serine hydrolase domain-containing protein | - |
M1775_RS07975 (M1775_07980) | 1690454..1691071 | - | 618 | WP_003407606.1 | class I SAM-dependent methyltransferase | - |
M1775_RS07980 (M1775_07985) | 1691285..1691476 | - | 192 | WP_003407609.1 | dodecin family protein | - |
M1775_RS07985 (M1775_07990) | 1691558..1691956 | + | 399 | WP_003900351.1 | hypothetical protein | - |
M1775_RS07990 (M1775_07995) | 1692001..1693029 | + | 1029 | WP_011799189.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T243929 WP_003407593.1 NZ_CP096846:1687721-1688038 [Mycobacterium tuberculosis variant bovis]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11173.42 Da Isoelectric Point: 9.5564
>AT243929 WP_003900349.1 NZ_CP096846:1687422-1687724 [Mycobacterium tuberculosis variant bovis]
VPFLVALSGIISGVRDHSMTVRLDQQTRQRLQDIVKGGYRSANAAIVDAINKRWEALHDEQLDAAYAAAIHDNPAYPYES
EAERSAARARRNARQQRSAQ
VPFLVALSGIISGVRDHSMTVRLDQQTRQRLQDIVKGGYRSANAAIVDAINKRWEALHDEQLDAAYAAAIHDNPAYPYES
EAERSAARARRNARQQRSAQ
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|