Detailed information of TA system TA242570

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-sokX/Ldr(toxin)
• Location: 2462909..2463130
• Replicon: chromosome
• Accession: NZ_CP095786
• Organism: Escherichia fergusonii strain EF21JD053

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A829L523
• Locus tag: MYB88_RS11820
• Protein ID: WP_000170738.1
• Coordinates: 2462909..2463016 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	sokX
Locus tag	-
Coordinates	2463064..2463130 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
MYB88_RS11790	2457959..2458147	-	189	WP_001063310.1	cellulose biosynthesis protein BcsR	-
MYB88_RS11795	2458434..2459993	+	1560	WP_001070267.1	cellulose biosynthesis c-di-GMP-binding protein BcsE	-
MYB88_RS11800	2459990..2460181	+	192	WP_000981122.1	cellulose biosynthesis protein BcsF	-
MYB88_RS11805	2460178..2461857	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
MYB88_RS11810	2461944..2462051	-	108	WP_149012441.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2462109..2462163	+	55	NuclAT_17	-	-
-	2462109..2462163	+	55	NuclAT_17	-	-
-	2462109..2462163	+	55	NuclAT_17	-	-
-	2462109..2462163	+	55	NuclAT_17	-	-
-	2462109..2462163	+	55	NuclAT_20	-	-
-	2462109..2462163	+	55	NuclAT_20	-	-
-	2462109..2462163	+	55	NuclAT_20	-	-
-	2462109..2462163	+	55	NuclAT_20	-	-
-	2462109..2462163	+	55	NuclAT_23	-	-
-	2462109..2462163	+	55	NuclAT_23	-	-
-	2462109..2462163	+	55	NuclAT_23	-	-
-	2462109..2462163	+	55	NuclAT_23	-	-
-	2462109..2462163	+	55	NuclAT_26	-	-
-	2462109..2462163	+	55	NuclAT_26	-	-
-	2462109..2462163	+	55	NuclAT_26	-	-
-	2462109..2462163	+	55	NuclAT_26	-	-
-	2462109..2462165	+	57	NuclAT_10	-	-
-	2462109..2462165	+	57	NuclAT_10	-	-
-	2462109..2462165	+	57	NuclAT_10	-	-
-	2462109..2462165	+	57	NuclAT_10	-	-
-	2462109..2462165	+	57	NuclAT_13	-	-
-	2462109..2462165	+	57	NuclAT_13	-	-
-	2462109..2462165	+	57	NuclAT_13	-	-
-	2462109..2462165	+	57	NuclAT_13	-	-
MYB88_RS11815	2462427..2462534	-	108	WP_002431793.1	type I toxin-antitoxin system toxin Ldr family protein	-
MYB88_RS11820	2462909..2463016	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2463064..2463130	+	67	-	-	Antitoxin
MYB88_RS11825	2463392..2463499	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2463548..2463611	+	64	NuclAT_15	-	-
-	2463548..2463611	+	64	NuclAT_15	-	-
-	2463548..2463611	+	64	NuclAT_15	-	-
-	2463548..2463611	+	64	NuclAT_15	-	-
-	2463548..2463611	+	64	NuclAT_18	-	-
-	2463548..2463611	+	64	NuclAT_18	-	-
-	2463548..2463611	+	64	NuclAT_18	-	-
-	2463548..2463611	+	64	NuclAT_18	-	-
-	2463548..2463611	+	64	NuclAT_21	-	-
-	2463548..2463611	+	64	NuclAT_21	-	-
-	2463548..2463611	+	64	NuclAT_21	-	-
-	2463548..2463611	+	64	NuclAT_21	-	-
-	2463548..2463611	+	64	NuclAT_24	-	-
-	2463548..2463611	+	64	NuclAT_24	-	-
-	2463548..2463611	+	64	NuclAT_24	-	-
-	2463548..2463611	+	64	NuclAT_24	-	-
-	2463548..2463613	+	66	NuclAT_11	-	-
-	2463548..2463613	+	66	NuclAT_11	-	-
-	2463548..2463613	+	66	NuclAT_11	-	-
-	2463548..2463613	+	66	NuclAT_11	-	-
-	2463548..2463613	+	66	NuclAT_8	-	-
-	2463548..2463613	+	66	NuclAT_8	-	-
-	2463548..2463613	+	66	NuclAT_8	-	-
-	2463548..2463613	+	66	NuclAT_8	-	-
MYB88_RS11830	2463936..2465132	+	1197	WP_180492127.1	methionine gamma-lyase	-
MYB88_RS11835	2465381..2466679	+	1299	WP_148047743.1	amino acid permease	-
MYB88_RS11840	2466695..2467906	-	1212	WP_181667968.1	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3864.67 Da
• Isoelectric Point: 9.0157

>T242570 WP_000170738.1 NZ_CP095786:c2463016-2462909 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Nucleotide

• Length: 108 bp

>T242570 NZ_OW848786:81584-82000 [Escherichia coli]
GTGAACAAGATCTATATGCTCGACACGAACATCTGCTCGTTCATCATGCGCGAGCAGCCTGAAGCAGTGCTTAAGAATCT
GGAGCAGGCGGTGCTGCGCGGTCACCGTATCGTGGTCTCGGCCATCACCTACTCCGAGATGCGCTTCGGCGCCACCGGTC
CAAAGGCATCGCCACGCCACGTGCAGCTGGTTGACGCGTTCTGCGCCCGTCTCGATGCCATCCTGCCCTGGGATCGCGCT
GCGGTGGATGCAACCACGGAGGTTAAGGTGGCGCTGCGCCTCGCCGGCACGCCGATCGGTCCAAACGACACGGCGATCGC
CGGGCACGCCATCGCCACCGGGGCAATACTGGTGACGAATAATGTGAGAGAGTTTGAGCGGGTGCCTGGACTGGTACTGG
AAGACTGGGCAGGATAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT242570 NZ_CP095786:2463064-2463130 [Escherichia fergusonii]
GGTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A829L523

Antitoxin