Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokX/Ldr(toxin) |
| Location | 2461944..2462163 | Replicon | chromosome |
| Accession | NZ_CP095786 | ||
| Organism | Escherichia fergusonii strain EF21JD053 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | - |
| Locus tag | MYB88_RS11810 | Protein ID | WP_149012441.1 |
| Coordinates | 2461944..2462051 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokX | ||
| Locus tag | - | ||
| Coordinates | 2462109..2462163 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MYB88_RS11785 (2457180) | 2457180..2457947 | - | 768 | WP_223684298.1 | cellulose biosynthesis protein BcsQ | - |
| MYB88_RS11790 (2457959) | 2457959..2458147 | - | 189 | WP_001063310.1 | cellulose biosynthesis protein BcsR | - |
| MYB88_RS11795 (2458434) | 2458434..2459993 | + | 1560 | WP_001070267.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| MYB88_RS11800 (2459990) | 2459990..2460181 | + | 192 | WP_000981122.1 | cellulose biosynthesis protein BcsF | - |
| MYB88_RS11805 (2460178) | 2460178..2461857 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
| MYB88_RS11810 (2461944) | 2461944..2462051 | - | 108 | WP_149012441.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_17 | - | Antitoxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_17 | - | Antitoxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_17 | - | Antitoxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_17 | - | Antitoxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_20 | - | Antitoxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_20 | - | Antitoxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_20 | - | Antitoxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_20 | - | Antitoxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_23 | - | Antitoxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_23 | - | Antitoxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_23 | - | Antitoxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_23 | - | Antitoxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_26 | - | Antitoxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_26 | - | Antitoxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_26 | - | Antitoxin |
| - (2462109) | 2462109..2462163 | + | 55 | NuclAT_26 | - | Antitoxin |
| - (2462109) | 2462109..2462165 | + | 57 | NuclAT_10 | - | - |
| - (2462109) | 2462109..2462165 | + | 57 | NuclAT_10 | - | - |
| - (2462109) | 2462109..2462165 | + | 57 | NuclAT_10 | - | - |
| - (2462109) | 2462109..2462165 | + | 57 | NuclAT_10 | - | - |
| - (2462109) | 2462109..2462165 | + | 57 | NuclAT_13 | - | - |
| - (2462109) | 2462109..2462165 | + | 57 | NuclAT_13 | - | - |
| - (2462109) | 2462109..2462165 | + | 57 | NuclAT_13 | - | - |
| - (2462109) | 2462109..2462165 | + | 57 | NuclAT_13 | - | - |
| MYB88_RS11815 (2462427) | 2462427..2462534 | - | 108 | WP_002431793.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| MYB88_RS11820 (2462909) | 2462909..2463016 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_16 | - | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_16 | - | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_16 | - | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_16 | - | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_19 | - | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_19 | - | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_19 | - | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_19 | - | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_22 | - | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_22 | - | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_22 | - | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_22 | - | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_25 | - | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_25 | - | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_25 | - | - |
| - (2463065) | 2463065..2463128 | + | 64 | NuclAT_25 | - | - |
| - (2463065) | 2463065..2463130 | + | 66 | NuclAT_12 | - | - |
| - (2463065) | 2463065..2463130 | + | 66 | NuclAT_12 | - | - |
| - (2463065) | 2463065..2463130 | + | 66 | NuclAT_12 | - | - |
| - (2463065) | 2463065..2463130 | + | 66 | NuclAT_12 | - | - |
| - (2463065) | 2463065..2463130 | + | 66 | NuclAT_9 | - | - |
| - (2463065) | 2463065..2463130 | + | 66 | NuclAT_9 | - | - |
| - (2463065) | 2463065..2463130 | + | 66 | NuclAT_9 | - | - |
| - (2463065) | 2463065..2463130 | + | 66 | NuclAT_9 | - | - |
| MYB88_RS11825 (2463392) | 2463392..2463499 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_15 | - | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_15 | - | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_15 | - | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_15 | - | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_18 | - | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_18 | - | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_18 | - | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_18 | - | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_21 | - | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_21 | - | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_21 | - | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_21 | - | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_24 | - | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_24 | - | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_24 | - | - |
| - (2463548) | 2463548..2463611 | + | 64 | NuclAT_24 | - | - |
| - (2463548) | 2463548..2463613 | + | 66 | NuclAT_11 | - | - |
| - (2463548) | 2463548..2463613 | + | 66 | NuclAT_11 | - | - |
| - (2463548) | 2463548..2463613 | + | 66 | NuclAT_11 | - | - |
| - (2463548) | 2463548..2463613 | + | 66 | NuclAT_11 | - | - |
| - (2463548) | 2463548..2463613 | + | 66 | NuclAT_8 | - | - |
| - (2463548) | 2463548..2463613 | + | 66 | NuclAT_8 | - | - |
| - (2463548) | 2463548..2463613 | + | 66 | NuclAT_8 | - | - |
| - (2463548) | 2463548..2463613 | + | 66 | NuclAT_8 | - | - |
| MYB88_RS11830 (2463936) | 2463936..2465132 | + | 1197 | WP_180492127.1 | methionine gamma-lyase | - |
| MYB88_RS11835 (2465381) | 2465381..2466679 | + | 1299 | WP_148047743.1 | amino acid permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3894.69 Da Isoelectric Point: 9.0157
>T242566 WP_149012441.1 NZ_CP095786:c2462051-2461944 [Escherichia fergusonii]
MTLAELGIAFWHDLAAPVITGILASMIVNWLNKRK
MTLAELGIAFWHDLAAPVITGILASMIVNWLNKRK
Download Length: 108 bp
>T242566 NZ_OW848785:c4086033-4085815 [Escherichia coli]
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA
Antitoxin
Download Length: 55 bp
>AT242566 NZ_CP095786:2462109-2462163 [Escherichia fergusonii]
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|