Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokX/Ldr(toxin)
Location 2461944..2462163 Replicon chromosome
Accession NZ_CP095786
Organism Escherichia fergusonii strain EF21JD053

Toxin (Protein)


Gene name ldrD Uniprot ID -
Locus tag MYB88_RS11810 Protein ID WP_149012441.1
Coordinates 2461944..2462051 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokX
Locus tag -
Coordinates 2462109..2462163 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MYB88_RS11785 (2457180) 2457180..2457947 - 768 WP_223684298.1 cellulose biosynthesis protein BcsQ -
MYB88_RS11790 (2457959) 2457959..2458147 - 189 WP_001063310.1 cellulose biosynthesis protein BcsR -
MYB88_RS11795 (2458434) 2458434..2459993 + 1560 WP_001070267.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
MYB88_RS11800 (2459990) 2459990..2460181 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
MYB88_RS11805 (2460178) 2460178..2461857 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
MYB88_RS11810 (2461944) 2461944..2462051 - 108 WP_149012441.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2462109) 2462109..2462163 + 55 NuclAT_17 - Antitoxin
- (2462109) 2462109..2462163 + 55 NuclAT_17 - Antitoxin
- (2462109) 2462109..2462163 + 55 NuclAT_17 - Antitoxin
- (2462109) 2462109..2462163 + 55 NuclAT_17 - Antitoxin
- (2462109) 2462109..2462163 + 55 NuclAT_20 - Antitoxin
- (2462109) 2462109..2462163 + 55 NuclAT_20 - Antitoxin
- (2462109) 2462109..2462163 + 55 NuclAT_20 - Antitoxin
- (2462109) 2462109..2462163 + 55 NuclAT_20 - Antitoxin
- (2462109) 2462109..2462163 + 55 NuclAT_23 - Antitoxin
- (2462109) 2462109..2462163 + 55 NuclAT_23 - Antitoxin
- (2462109) 2462109..2462163 + 55 NuclAT_23 - Antitoxin
- (2462109) 2462109..2462163 + 55 NuclAT_23 - Antitoxin
- (2462109) 2462109..2462163 + 55 NuclAT_26 - Antitoxin
- (2462109) 2462109..2462163 + 55 NuclAT_26 - Antitoxin
- (2462109) 2462109..2462163 + 55 NuclAT_26 - Antitoxin
- (2462109) 2462109..2462163 + 55 NuclAT_26 - Antitoxin
- (2462109) 2462109..2462165 + 57 NuclAT_10 - -
- (2462109) 2462109..2462165 + 57 NuclAT_10 - -
- (2462109) 2462109..2462165 + 57 NuclAT_10 - -
- (2462109) 2462109..2462165 + 57 NuclAT_10 - -
- (2462109) 2462109..2462165 + 57 NuclAT_13 - -
- (2462109) 2462109..2462165 + 57 NuclAT_13 - -
- (2462109) 2462109..2462165 + 57 NuclAT_13 - -
- (2462109) 2462109..2462165 + 57 NuclAT_13 - -
MYB88_RS11815 (2462427) 2462427..2462534 - 108 WP_002431793.1 type I toxin-antitoxin system toxin Ldr family protein -
MYB88_RS11820 (2462909) 2462909..2463016 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2463065) 2463065..2463128 + 64 NuclAT_16 - -
- (2463065) 2463065..2463128 + 64 NuclAT_16 - -
- (2463065) 2463065..2463128 + 64 NuclAT_16 - -
- (2463065) 2463065..2463128 + 64 NuclAT_16 - -
- (2463065) 2463065..2463128 + 64 NuclAT_19 - -
- (2463065) 2463065..2463128 + 64 NuclAT_19 - -
- (2463065) 2463065..2463128 + 64 NuclAT_19 - -
- (2463065) 2463065..2463128 + 64 NuclAT_19 - -
- (2463065) 2463065..2463128 + 64 NuclAT_22 - -
- (2463065) 2463065..2463128 + 64 NuclAT_22 - -
- (2463065) 2463065..2463128 + 64 NuclAT_22 - -
- (2463065) 2463065..2463128 + 64 NuclAT_22 - -
- (2463065) 2463065..2463128 + 64 NuclAT_25 - -
- (2463065) 2463065..2463128 + 64 NuclAT_25 - -
- (2463065) 2463065..2463128 + 64 NuclAT_25 - -
- (2463065) 2463065..2463128 + 64 NuclAT_25 - -
- (2463065) 2463065..2463130 + 66 NuclAT_12 - -
- (2463065) 2463065..2463130 + 66 NuclAT_12 - -
- (2463065) 2463065..2463130 + 66 NuclAT_12 - -
- (2463065) 2463065..2463130 + 66 NuclAT_12 - -
- (2463065) 2463065..2463130 + 66 NuclAT_9 - -
- (2463065) 2463065..2463130 + 66 NuclAT_9 - -
- (2463065) 2463065..2463130 + 66 NuclAT_9 - -
- (2463065) 2463065..2463130 + 66 NuclAT_9 - -
MYB88_RS11825 (2463392) 2463392..2463499 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2463548) 2463548..2463611 + 64 NuclAT_15 - -
- (2463548) 2463548..2463611 + 64 NuclAT_15 - -
- (2463548) 2463548..2463611 + 64 NuclAT_15 - -
- (2463548) 2463548..2463611 + 64 NuclAT_15 - -
- (2463548) 2463548..2463611 + 64 NuclAT_18 - -
- (2463548) 2463548..2463611 + 64 NuclAT_18 - -
- (2463548) 2463548..2463611 + 64 NuclAT_18 - -
- (2463548) 2463548..2463611 + 64 NuclAT_18 - -
- (2463548) 2463548..2463611 + 64 NuclAT_21 - -
- (2463548) 2463548..2463611 + 64 NuclAT_21 - -
- (2463548) 2463548..2463611 + 64 NuclAT_21 - -
- (2463548) 2463548..2463611 + 64 NuclAT_21 - -
- (2463548) 2463548..2463611 + 64 NuclAT_24 - -
- (2463548) 2463548..2463611 + 64 NuclAT_24 - -
- (2463548) 2463548..2463611 + 64 NuclAT_24 - -
- (2463548) 2463548..2463611 + 64 NuclAT_24 - -
- (2463548) 2463548..2463613 + 66 NuclAT_11 - -
- (2463548) 2463548..2463613 + 66 NuclAT_11 - -
- (2463548) 2463548..2463613 + 66 NuclAT_11 - -
- (2463548) 2463548..2463613 + 66 NuclAT_11 - -
- (2463548) 2463548..2463613 + 66 NuclAT_8 - -
- (2463548) 2463548..2463613 + 66 NuclAT_8 - -
- (2463548) 2463548..2463613 + 66 NuclAT_8 - -
- (2463548) 2463548..2463613 + 66 NuclAT_8 - -
MYB88_RS11830 (2463936) 2463936..2465132 + 1197 WP_180492127.1 methionine gamma-lyase -
MYB88_RS11835 (2465381) 2465381..2466679 + 1299 WP_148047743.1 amino acid permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3894.69 Da        Isoelectric Point: 9.0157

>T242566 WP_149012441.1 NZ_CP095786:c2462051-2461944 [Escherichia fergusonii]
MTLAELGIAFWHDLAAPVITGILASMIVNWLNKRK

Download         Length: 108 bp

>T242566 NZ_OW848785:c4086033-4085815 [Escherichia coli]
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA

Antitoxin


Download         Length: 55 bp

>AT242566 NZ_CP095786:2462109-2462163 [Escherichia fergusonii]
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References