Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1636055..1636269 Replicon chromosome
Accession NC_013008
Organism Escherichia coli O157:H7 str. TW14359

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag ECSP_RS08305 Protein ID WP_000170963.1
Coordinates 1636055..1636162 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1636210..1636269 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECSP_RS08275 1631364..1632446 + 1083 WP_000804726.1 peptide chain release factor 1 -
ECSP_RS08280 1632446..1633279 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
ECSP_RS08285 1633276..1633668 + 393 WP_000200379.1 invasion regulator SirB2 -
ECSP_RS08290 1633672..1634481 + 810 WP_001257044.1 invasion regulator SirB1 -
ECSP_RS08295 1634517..1635371 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
ECSP_RS08300 1635519..1635626 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1635679..1635740 + 62 NuclAT_24 - -
- 1635679..1635740 + 62 NuclAT_24 - -
- 1635679..1635740 + 62 NuclAT_24 - -
- 1635679..1635740 + 62 NuclAT_24 - -
- 1635679..1635740 + 62 NuclAT_26 - -
- 1635679..1635740 + 62 NuclAT_26 - -
- 1635679..1635740 + 62 NuclAT_26 - -
- 1635679..1635740 + 62 NuclAT_26 - -
- 1635679..1635740 + 62 NuclAT_28 - -
- 1635679..1635740 + 62 NuclAT_28 - -
- 1635679..1635740 + 62 NuclAT_28 - -
- 1635679..1635740 + 62 NuclAT_28 - -
- 1635679..1635740 + 62 NuclAT_30 - -
- 1635679..1635740 + 62 NuclAT_30 - -
- 1635679..1635740 + 62 NuclAT_30 - -
- 1635679..1635740 + 62 NuclAT_30 - -
- 1635679..1635740 + 62 NuclAT_32 - -
- 1635679..1635740 + 62 NuclAT_32 - -
- 1635679..1635740 + 62 NuclAT_32 - -
- 1635679..1635740 + 62 NuclAT_32 - -
- 1635679..1635741 + 63 NuclAT_17 - -
- 1635679..1635741 + 63 NuclAT_17 - -
- 1635679..1635741 + 63 NuclAT_17 - -
- 1635679..1635741 + 63 NuclAT_17 - -
- 1635679..1635741 + 63 NuclAT_18 - -
- 1635679..1635741 + 63 NuclAT_18 - -
- 1635679..1635741 + 63 NuclAT_18 - -
- 1635679..1635741 + 63 NuclAT_18 - -
- 1635679..1635741 + 63 NuclAT_19 - -
- 1635679..1635741 + 63 NuclAT_19 - -
- 1635679..1635741 + 63 NuclAT_19 - -
- 1635679..1635741 + 63 NuclAT_19 - -
- 1635679..1635741 + 63 NuclAT_20 - -
- 1635679..1635741 + 63 NuclAT_20 - -
- 1635679..1635741 + 63 NuclAT_20 - -
- 1635679..1635741 + 63 NuclAT_20 - -
- 1635679..1635741 + 63 NuclAT_22 - -
- 1635679..1635741 + 63 NuclAT_22 - -
- 1635679..1635741 + 63 NuclAT_22 - -
- 1635679..1635741 + 63 NuclAT_22 - -
- 1635679..1635741 + 63 NuclAT_23 - -
- 1635679..1635741 + 63 NuclAT_23 - -
- 1635679..1635741 + 63 NuclAT_23 - -
- 1635679..1635741 + 63 NuclAT_23 - -
ECSP_RS08305 1636055..1636162 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1636210..1636269 + 60 NuclAT_25 - Antitoxin
- 1636210..1636269 + 60 NuclAT_25 - Antitoxin
- 1636210..1636269 + 60 NuclAT_25 - Antitoxin
- 1636210..1636269 + 60 NuclAT_25 - Antitoxin
- 1636210..1636269 + 60 NuclAT_27 - Antitoxin
- 1636210..1636269 + 60 NuclAT_27 - Antitoxin
- 1636210..1636269 + 60 NuclAT_27 - Antitoxin
- 1636210..1636269 + 60 NuclAT_27 - Antitoxin
- 1636210..1636269 + 60 NuclAT_29 - Antitoxin
- 1636210..1636269 + 60 NuclAT_29 - Antitoxin
- 1636210..1636269 + 60 NuclAT_29 - Antitoxin
- 1636210..1636269 + 60 NuclAT_29 - Antitoxin
- 1636210..1636269 + 60 NuclAT_31 - Antitoxin
- 1636210..1636269 + 60 NuclAT_31 - Antitoxin
- 1636210..1636269 + 60 NuclAT_31 - Antitoxin
- 1636210..1636269 + 60 NuclAT_31 - Antitoxin
- 1636210..1636269 + 60 NuclAT_33 - Antitoxin
- 1636210..1636269 + 60 NuclAT_33 - Antitoxin
- 1636210..1636269 + 60 NuclAT_33 - Antitoxin
- 1636210..1636269 + 60 NuclAT_33 - Antitoxin
ECSP_RS08310 1636561..1637661 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
ECSP_RS08315 1637931..1638161 + 231 WP_001146444.1 putative cation transport regulator ChaB -
ECSP_RS08320 1638322..1639017 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
ECSP_RS08325 1639061..1639414 - 354 WP_001169661.1 DsrE/F sulfur relay family protein YchN -
ECSP_RS08330 1639600..1640994 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T24184 WP_000170963.1 NC_013008:c1636162-1636055 [Escherichia coli O157:H7 str. TW14359]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T24184 NC_013008:c1636162-1636055 [Escherichia coli O157:H7 str. TW14359]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT24184 NC_013008:1636210-1636269 [Escherichia coli O157:H7 str. TW14359]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References