Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2223120..2223334 Replicon chromosome
Accession NZ_CP089031
Organism Escherichia coli strain 7386Nal

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag CO543_RS11320 Protein ID WP_000170963.1
Coordinates 2223120..2223227 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2223275..2223334 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CO543_RS11290 (2218429) 2218429..2219511 + 1083 WP_000804726.1 peptide chain release factor 1 -
CO543_RS11295 (2219511) 2219511..2220344 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
CO543_RS11300 (2220341) 2220341..2220733 + 393 WP_000200379.1 invasion regulator SirB2 -
CO543_RS11305 (2220737) 2220737..2221546 + 810 WP_001257044.1 invasion regulator SirB1 -
CO543_RS11310 (2221582) 2221582..2222436 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
CO543_RS11315 (2222584) 2222584..2222691 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2222744) 2222744..2222805 + 62 NuclAT_24 - -
- (2222744) 2222744..2222805 + 62 NuclAT_24 - -
- (2222744) 2222744..2222805 + 62 NuclAT_24 - -
- (2222744) 2222744..2222805 + 62 NuclAT_24 - -
- (2222744) 2222744..2222805 + 62 NuclAT_26 - -
- (2222744) 2222744..2222805 + 62 NuclAT_26 - -
- (2222744) 2222744..2222805 + 62 NuclAT_26 - -
- (2222744) 2222744..2222805 + 62 NuclAT_26 - -
- (2222744) 2222744..2222805 + 62 NuclAT_28 - -
- (2222744) 2222744..2222805 + 62 NuclAT_28 - -
- (2222744) 2222744..2222805 + 62 NuclAT_28 - -
- (2222744) 2222744..2222805 + 62 NuclAT_28 - -
- (2222744) 2222744..2222805 + 62 NuclAT_30 - -
- (2222744) 2222744..2222805 + 62 NuclAT_30 - -
- (2222744) 2222744..2222805 + 62 NuclAT_30 - -
- (2222744) 2222744..2222805 + 62 NuclAT_30 - -
- (2222744) 2222744..2222805 + 62 NuclAT_32 - -
- (2222744) 2222744..2222805 + 62 NuclAT_32 - -
- (2222744) 2222744..2222805 + 62 NuclAT_32 - -
- (2222744) 2222744..2222805 + 62 NuclAT_32 - -
- (2222744) 2222744..2222806 + 63 NuclAT_17 - -
- (2222744) 2222744..2222806 + 63 NuclAT_17 - -
- (2222744) 2222744..2222806 + 63 NuclAT_17 - -
- (2222744) 2222744..2222806 + 63 NuclAT_17 - -
- (2222744) 2222744..2222806 + 63 NuclAT_18 - -
- (2222744) 2222744..2222806 + 63 NuclAT_18 - -
- (2222744) 2222744..2222806 + 63 NuclAT_18 - -
- (2222744) 2222744..2222806 + 63 NuclAT_18 - -
- (2222744) 2222744..2222806 + 63 NuclAT_19 - -
- (2222744) 2222744..2222806 + 63 NuclAT_19 - -
- (2222744) 2222744..2222806 + 63 NuclAT_19 - -
- (2222744) 2222744..2222806 + 63 NuclAT_19 - -
- (2222744) 2222744..2222806 + 63 NuclAT_20 - -
- (2222744) 2222744..2222806 + 63 NuclAT_20 - -
- (2222744) 2222744..2222806 + 63 NuclAT_20 - -
- (2222744) 2222744..2222806 + 63 NuclAT_20 - -
- (2222744) 2222744..2222806 + 63 NuclAT_22 - -
- (2222744) 2222744..2222806 + 63 NuclAT_22 - -
- (2222744) 2222744..2222806 + 63 NuclAT_22 - -
- (2222744) 2222744..2222806 + 63 NuclAT_22 - -
- (2222744) 2222744..2222806 + 63 NuclAT_23 - -
- (2222744) 2222744..2222806 + 63 NuclAT_23 - -
- (2222744) 2222744..2222806 + 63 NuclAT_23 - -
- (2222744) 2222744..2222806 + 63 NuclAT_23 - -
CO543_RS11320 (2223120) 2223120..2223227 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2223275) 2223275..2223334 + 60 NuclAT_25 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_25 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_25 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_25 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_27 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_27 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_27 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_27 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_29 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_29 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_29 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_29 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_31 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_31 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_31 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_31 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_33 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_33 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_33 - Antitoxin
- (2223275) 2223275..2223334 + 60 NuclAT_33 - Antitoxin
CO543_RS11325 (2223626) 2223626..2224726 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
CO543_RS11330 (2224996) 2224996..2225226 + 231 WP_001146444.1 putative cation transport regulator ChaB -
CO543_RS11335 (2225387) 2225387..2226082 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
CO543_RS11340 (2226126) 2226126..2226479 - 354 WP_001169661.1 DsrE/F sulfur relay family protein YchN -
CO543_RS11345 (2226665) 2226665..2228059 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T227435 WP_000170963.1 NZ_CP089031:c2223227-2223120 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T227435 NZ_CP122873:26780-27028 [Escherichia coli]
ATGGGGAAAACAGATAAGCTACAGGCAAAGTTTTTAAACAGTAAAAAAACGTTTGAATGGGATGAACTGGTCGTTTTGTT
TTCCTCTTTGGGATATGTCAAAAAGGAAATGCAGGGGTCAAGAGTGCGGTTTTTCAATGCTGAAATCAATCACACCATAT
TAATGCATCGTCCACATCCGGAAAGTTATATCAAAGGTGGTACGCTGAAAGCAATTAAACAGAATCTGAAAGAGGCTGGA
TTATTATGA

Antitoxin


Download         Length: 60 bp

>AT227435 NZ_CP089031:2223275-2223334 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References