Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4451656..4451878 Replicon chromosome
Accession NZ_CP087294
Organism Escherichia coli strain APEC E956

Toxin (Protein)


Gene name ldrD Uniprot ID A0A829L523
Locus tag LO740_RS21625 Protein ID WP_000170738.1
Coordinates 4451656..4451763 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4451812..4451878 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LO740_RS21595 4446685..4448256 + 1572 WP_001204944.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
LO740_RS21600 4448253..4448444 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
LO740_RS21605 4448441..4450120 + 1680 WP_001562264.1 cellulose biosynthesis protein BcsG -
LO740_RS21610 4450207..4450314 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
LO740_RS21615 4450690..4450797 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
LO740_RS21620 4451173..4451280 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
LO740_RS21625 4451656..4451763 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4451812..4451878 + 67 - - Antitoxin
LO740_RS21630 4452239..4453510 + 1272 WP_001318103.1 aromatic amino acid transport family protein -
LO740_RS21635 4453540..4454544 - 1005 WP_000107036.1 dipeptide ABC transporter ATP-binding subunit DppF -
LO740_RS21640 4454541..4455524 - 984 WP_001196486.1 dipeptide ABC transporter ATP-binding protein -
LO740_RS21645 4455535..4456437 - 903 WP_000084677.1 dipeptide ABC transporter permease DppC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3864.67 Da        Isoelectric Point: 9.0157

>T225327 WP_000170738.1 NZ_CP087294:c4451763-4451656 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Download         Length: 108 bp

>T225327 NZ_CP121133:c3298172-3298070 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT

Antitoxin


Download         Length: 67 bp

>AT225327 NZ_CP087294:4451812-4451878 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829L523

Antitoxin

Download structure file

References