Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2018069..2018290 Replicon chromosome
Accession NZ_CP087287
Organism Escherichia coli strain APEC 16-1068

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag LO742_RS10010 Protein ID WP_000170954.1
Coordinates 2018069..2018176 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2018229..2018290 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LO742_RS09985 (2013914) 2013914..2014996 + 1083 WP_000804726.1 peptide chain release factor 1 -
LO742_RS09990 (2014996) 2014996..2015829 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
LO742_RS09995 (2015826) 2015826..2016218 + 393 WP_000200375.1 invasion regulator SirB2 -
LO742_RS10000 (2016222) 2016222..2017031 + 810 WP_001257054.1 invasion regulator SirB1 -
LO742_RS10005 (2017067) 2017067..2017921 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
LO742_RS10010 (2018069) 2018069..2018176 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2018229) 2018229..2018290 + 62 NuclAT_12 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_12 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_12 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_12 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_13 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_13 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_13 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_13 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_14 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_14 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_14 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_14 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_15 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_15 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_15 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_15 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_16 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_16 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_16 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_16 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_17 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_17 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_17 - Antitoxin
- (2018229) 2018229..2018290 + 62 NuclAT_17 - Antitoxin
- (2018229) 2018229..2018291 + 63 NuclAT_10 - -
- (2018229) 2018229..2018291 + 63 NuclAT_10 - -
- (2018229) 2018229..2018291 + 63 NuclAT_10 - -
- (2018229) 2018229..2018291 + 63 NuclAT_10 - -
- (2018229) 2018229..2018291 + 63 NuclAT_11 - -
- (2018229) 2018229..2018291 + 63 NuclAT_11 - -
- (2018229) 2018229..2018291 + 63 NuclAT_11 - -
- (2018229) 2018229..2018291 + 63 NuclAT_11 - -
- (2018229) 2018229..2018291 + 63 NuclAT_6 - -
- (2018229) 2018229..2018291 + 63 NuclAT_6 - -
- (2018229) 2018229..2018291 + 63 NuclAT_6 - -
- (2018229) 2018229..2018291 + 63 NuclAT_6 - -
- (2018229) 2018229..2018291 + 63 NuclAT_7 - -
- (2018229) 2018229..2018291 + 63 NuclAT_7 - -
- (2018229) 2018229..2018291 + 63 NuclAT_7 - -
- (2018229) 2018229..2018291 + 63 NuclAT_7 - -
- (2018229) 2018229..2018291 + 63 NuclAT_8 - -
- (2018229) 2018229..2018291 + 63 NuclAT_8 - -
- (2018229) 2018229..2018291 + 63 NuclAT_8 - -
- (2018229) 2018229..2018291 + 63 NuclAT_8 - -
- (2018229) 2018229..2018291 + 63 NuclAT_9 - -
- (2018229) 2018229..2018291 + 63 NuclAT_9 - -
- (2018229) 2018229..2018291 + 63 NuclAT_9 - -
- (2018229) 2018229..2018291 + 63 NuclAT_9 - -
- (2018229) 2018229..2018292 + 64 NuclAT_18 - -
- (2018229) 2018229..2018292 + 64 NuclAT_18 - -
- (2018229) 2018229..2018292 + 64 NuclAT_18 - -
- (2018229) 2018229..2018292 + 64 NuclAT_18 - -
- (2018229) 2018229..2018292 + 64 NuclAT_19 - -
- (2018229) 2018229..2018292 + 64 NuclAT_19 - -
- (2018229) 2018229..2018292 + 64 NuclAT_19 - -
- (2018229) 2018229..2018292 + 64 NuclAT_19 - -
- (2018229) 2018229..2018292 + 64 NuclAT_20 - -
- (2018229) 2018229..2018292 + 64 NuclAT_20 - -
- (2018229) 2018229..2018292 + 64 NuclAT_20 - -
- (2018229) 2018229..2018292 + 64 NuclAT_20 - -
- (2018229) 2018229..2018292 + 64 NuclAT_21 - -
- (2018229) 2018229..2018292 + 64 NuclAT_21 - -
- (2018229) 2018229..2018292 + 64 NuclAT_21 - -
- (2018229) 2018229..2018292 + 64 NuclAT_21 - -
- (2018229) 2018229..2018292 + 64 NuclAT_22 - -
- (2018229) 2018229..2018292 + 64 NuclAT_22 - -
- (2018229) 2018229..2018292 + 64 NuclAT_22 - -
- (2018229) 2018229..2018292 + 64 NuclAT_22 - -
- (2018229) 2018229..2018292 + 64 NuclAT_23 - -
- (2018229) 2018229..2018292 + 64 NuclAT_23 - -
- (2018229) 2018229..2018292 + 64 NuclAT_23 - -
- (2018229) 2018229..2018292 + 64 NuclAT_23 - -
LO742_RS10015 (2018582) 2018582..2019682 - 1101 WP_001313768.1 sodium-potassium/proton antiporter ChaA -
LO742_RS10020 (2019952) 2019952..2020182 + 231 WP_001146444.1 putative cation transport regulator ChaB -
LO742_RS10025 (2020340) 2020340..2021035 + 696 WP_000632706.1 glutathione-specific gamma-glutamylcyclotransferase -
LO742_RS10030 (2021079) 2021079..2021432 - 354 WP_001169658.1 DsrE/F sulfur relay family protein YchN -
LO742_RS10035 (2021617) 2021617..2023011 + 1395 WP_000086194.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T225221 WP_000170954.1 NZ_CP087287:c2018176-2018069 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T225221 NZ_CP121075:c1343782-1343255 [Salmonella enterica subsp. enterica serovar Infantis]
ATGATGTTTACAGACTGGCATGAGGCCGCGATAGGGAAAACCCACAATCGAATGAATTTTGATTGTGGGGATGCCGATCT
GAACCAATTCCTACAACGCCATGCACTACAAAATCATGAGAAAGGGACAACGAAAACCTATGTTGCGCTTGATAATTCGG
ATGTTACACGTATCCACGGCTTTTACTCAGTCAGTCCTGCATCACTGATATATGCACAGGTTCCCGGCGCAATCAGCAAA
GGATTAGGGAGATATGATGTGCCAGTGTTTCGTCTGGGTCGTTTAGCCGTAGACAAATCTATGCAGGGGCAAGGGCTGGG
AGCACAACTTTTGTTATCTGCCGGAAAGCGTTGCATACAGGCGGCTTTGCAGGTCGGCGGCGTAGCCCTGCTTATTGATG
CCAAAAATAAACAGGTCTGCGACTGGTACAAAGGATTTGGCGCAGTACCATTAAACAATCAACCCCTTTCCTTGTTGCTG
TCGTTTAAAACGCTTTATGCTGCTTTATCTGCATCTGGTAGGTTATGA

Antitoxin


Download         Length: 62 bp

>AT225221 NZ_CP087287:2018229-2018290 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References