Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 14815..15085 | Replicon | plasmid pAPEC-O1-ColBM |
| Accession | NC_009837 | ||
| Organism | Escherichia coli APEC O1 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | APECO1_RS25795 | Protein ID | WP_001312861.1 |
| Coordinates | 14927..15085 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 14815..14878 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| APECO1_RS30710 | 9870..10136 | + | 267 | WP_072254135.1 | hypothetical protein | - |
| APECO1_RS25765 | 10609..11136 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| APECO1_RS25770 | 11192..11425 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| APECO1_RS25775 | 11484..13442 | + | 1959 | WP_001145470.1 | ParB/RepB/Spo0J family partition protein | - |
| APECO1_RS25780 | 13497..13931 | + | 435 | WP_000845949.1 | conjugation system SOS inhibitor PsiB | - |
| APECO1_RS25785 | 13928..14647 | + | 720 | WP_001276228.1 | plasmid SOS inhibition protein A | - |
| APECO1_RS31660 | 14659..14847 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 14659..14883 | + | 225 | NuclAT_0 | - | - |
| - | 14659..14883 | + | 225 | NuclAT_0 | - | - |
| - | 14659..14883 | + | 225 | NuclAT_0 | - | - |
| - | 14659..14883 | + | 225 | NuclAT_0 | - | - |
| - | 14815..14878 | - | 64 | - | - | Antitoxin |
| APECO1_RS25795 | 14927..15085 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| APECO1_RS30720 | 15776..15982 | + | 207 | WP_000547939.1 | hypothetical protein | - |
| APECO1_RS25805 | 16007..16294 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| APECO1_RS25810 | 16415..17236 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| APECO1_RS25815 | 17533..18135 | - | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
| APECO1_RS25820 | 18456..18839 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| APECO1_RS25825 | 19026..19715 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / iroN / iroE / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA | 1..174241 | 174241 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T22475 WP_001312861.1 NC_009837:14927-15085 [Escherichia coli APEC O1]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T22475 NC_009837:14927-15085 [Escherichia coli APEC O1]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT22475 NC_009837:c14878-14815 [Escherichia coli APEC O1]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|